Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G24170-AT1G70090
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Nucleotide-diphospho-sugar transferases superfamily protein
Function (paralog2):glucosyl transferase family 8

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-0.72138846054435
Log2 mRNA fold difference:-0.25710726625672
Log2 TE fold difference:-0.50703424425664
Sequences
Protein sequence

MSSRFSLTVVCLIALLPFVVGIRLIPARITSVGDGGGGGGNNGFSKLGPFMEAPEYRNGK
ECVSSSVNRENFVSSSSSSNDPSLVHIAMTLDSEYLRGSIAAVHSVLRHASCPENVFFHF
IAAEFDSASPRVLSQLVRSTFPSLNFKVYIFREDTVINLISSSIRLALENPLNYARNYLG
DILDRSVERVIYLDSDVITVDDITKLWNTVLTGSRVIGAPEYCHANFTQYFTSGFWSDPA
LPGLISGQKPCYFNTGVMVMDLVRWREGNYREKLEQWMQLQKKMRIYDLGSLPPFLLVFA
GNVEAIDHRWNQHGLGGDNIRGSCRSLHPGPVSLLHWSGKGKPWVRLDEKRPCPLDHLWE
PYDLYKHKIERAKDQSLLGFASLSELTDDSSFL

MRLRFPMKSAVLAFAIFLVFIPLFSVGIRMIPGRLTAVSATVGNGFDLGSFVEAPEYRNG
KECVSQSLNRENFVSSCDASLVHVAMTLDSEYLRGSIAAVHSMLRHASCPENVFFHLIAA
EFDPASPRVLSQLVRSTFPSLNFKVYIFREDTVINLISSSIRQALENPLNYARNYLGDIL
DPCVDRVIYLDSDIIVVDDITKLWNTSLTGSRIIGAPEYCHANFTKYFTSGFWSDPALPG
FFSGRKPCYFNTGVMVMDLVRWREGNYREKLETWMQIQKKKRIYDLGSLPPFLLVFAGNV
EAIDHRWNQHGLGGDNVRGSCRSLHKGPVSLLHWSGKGKPWVRLDEKRPCPLDHLWEPYD
LYEHKIERAKDQSLFGFSSLSELTEDSSFF

www.000webhost.com

Other information
Ka divergence:-0.272998KaKs divergence:-0.11941
GC content 1 (%):45GC content 2 (%):46GC content divergence:0.011
Length 1 (bp):1182Length 2 (bp):1173Length divergence:-0.004
MFE 1 (kcal):-369.4MFE 2 (kcal):-370.73MFE divergence0.002