Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G24190-AT1G70060
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):SIN3-like 3
Function (paralog2):SIN3-like 4

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-0.31270797245073
Log2 mRNA fold difference:0.24684686153498
Log2 TE fold difference:-0.51338025405308
Sequences
Protein sequence

MVGGGSAQKLTTNDALAYLKAVKDKFQDQRGKYDEFLEVMKNFKSQRVDTAGVITRVKEL
FKGHQELILGFNTFLPKGFEITLQPEDGQPPLKKRVEFEEAISFVNKIKTRFQGDDRVYK
SFLDILNMYRRDSKSITEVYQEVAILFRDHSDLLVEFTHFLPDTSATASIPSVKTSVRER
GVSLADKKDRIITPHPDHDYGTEHIDQDRERPIKKENKEHMRGTNKENEHRDARDFEPHS
KKEQFLNKKQKLHIRGDDPAEISNQSKLSGAVPSSSTYDEKGAMKSYSQDLAIVDRVKEK
LNASEYQEFLRCLNLFSKEIISRPELQSLVGNLIGVYPDLMDSFIEFLVQCEKNEGLLSG
ILTKSKSTYLLQGEGKYPQPSLDNDRDQEHKRDDGLRDRDHEKERLEKAAANLKWAKPIS
ELDLSNCEQCTPSYRLLPKNYPISIASQKTEIGKLVLNDHWVSVTSGSEDYSFSHMRKNQ
YEESLFKCEDDRFELDMLLESVNSTTKHVEELLTKINSNELKTNSPIRVEDHLTALNLRC
IERLYGDHGLDVMDVLKKNVSLALPVILTRLKQKQEEWARCRSDFDKVWAEIYAKNYYKS
LDHRSFYFKQQDSKKLSMKALLAEIKEITEKKREDDSLLAFAAGNRLSISPDLEFDYPDH
DLHEDLYQLIKYSCAEMCSTEQLDKVMKIWTTFVEQIFGVPSRPQGAEDQEDVVKSMNQN
VKSGSSSAGESEGSPHNYASVADSRRSKSSRKANEHSQLGQTSNSERDGAAGRTSDALCE
TAQHEKMLKNVVTSDEKPESKQAVSIERAHDSTALAVDGLLDQSNGGSSIVHMTGHCNNN
LKPVTCGTELELKMNDGNGPKLEVGNKKLLTNGIAVEITSDQEMAGTSKVEREEGELSPN
GDFEEDNFAVYAKTDFETFSKANDSTGNNISGDRSREGEPSCLETRAENDAEGDENAARS
SEDSRNEYENGDVSGTESGGGEDPEDDLDNNNKGESEGEAECMADAHDAEENGSALPVSA
RFLLHVKPLVKYVPSAIALHDKDKDSLKNSQVFYGNDSFYVLFRLHRILYERILSAKVNS
SSPEGKWRTSNTKNPTDSYARFMTALYNLLDGTSDNAKFEDDCRAIIGTQSYILFTLDKL
IHKFIKHLQVVVADEMDNKLLQLYFYEKSRRPETIFDAVYYDNTRVLLPDENIYRIECRL
STPAKLSIQLMCNGLDKPDVTSVSIDPTFAAYLHNDFLSIQPNAREDRRIYLNRNKRKVC
REDEQLYSTDEVKIKNGLECKIACGSSKVSYVLETEDLLVRVKKRRKTLCHNQDSWVRQM
RLQYYKNNFL

MVGGSSAQKLTTNDALAYLKAVKDKFQDKRDKYDEFLEVMKDFKAQRVDTTGVILRVKEL
FKGNRELILGFNTFLPKGFEITLRPEDDQPAAPKKPVEFEEAISFVNKIKTRFQGDDRVY
KSFLDILNMYRKENKSITEVYHEVAILFRDHHDLLGEFTHFLPDTSATASTNDSVKVPVR
DRGIKSLPTMRQIDLDKKDRIITSHPNRALKTENMDVDHERSLLKDSKEEVRRIDKKNDF
MDDRDRKDYRGLDHDSHKEHFFNSKKKLIRKDDDSAEMSDQAREGDKFSGAIPSSSTYDE
KGHSQELAFVDRVKAKLDTADNQEFLRCLNLYSKEIISQPELQSLVSDLIGVYPDLMDAF
KVFLAQCDKNDGLLSGIVSKKSLWSEGKCPQPTKSLDKDTDREREKIERYRERDREKERL
EKVAASQKWAKPISELDLSNCEQCTPSYRRLPKNYPIPIASQKMEIGSQVLNDHWVSVTS
GSEDYSFKHMRKNQYEESLFKCEDDRFELDMLLESVISATNRVEELLAKINSNELKTDTP
ICIEDHLTALNLRCIERLYSDHGLDVLDLLKKNAYLALPVILTRLKQKQEEWARCRTEFN
KVWADIYTKNYHRSLDHRSFYFKQQDSKNLSTKALLAEIKEISEKKRGEDDALLALAAGN
RRTISSNMSFDYPDPDLHEDLYQLIKYSCGEMCSTEQLDKVMKVWTEFLEPIFGVPSRPQ
GAEDREDAVKSTNHDREDQEDAVSPQNGASIANSMRSNGPRKVNESNQVRQASELDKDVT
SSKTSDALLSCDNTQNDKMPKNLTTPDERAETKQAVSIERAHNSNALPLDGLLPQRNGKI
SSLSVAGLSNSNPKPALTSGTEELKPNYVNGPRVEIGDNPVIPNGTVAEWFAGEAKVERE
EGELSPTGDFEEDNYAVHGENDMEALSKSKENDATADDASAPRSSDGSGNTSHNGDVSGT
DSGDGEDCYREDDIDHNKVESEGEAEEGMSDGHDDTEGDMPVLSISVKNLLHVKPLAKYV
PPALYDKDNDDSRKNSQVFYGNDSFYVLFRLHQILYDRILSAKINSSSPDRKWKTSNPTN
PADSYARIMDALYNLLDGTSDNSKFEDDCRAIIGTQSYVLFTLDKLIYKLIKHLQAVAAD
EMDNKLQQLYAYEKSRKPEKFLDAVYYENALVLLPDEDIYRIECEQSTPSKLSIQLLDYG
HDKPDVTSISMDPTFAAYLHNVFLSYQPNAKENPRIYLKRNKRKNGGDDELCTTDEVKII
NGLECKITCSSSKVSYVLDTEDVLHRAKRRKLLNQSGLPLAHDSVCSGSLIRQRRTQRYQ
KLLTGQ

Other information
Ka divergence:-0.0405151KaKs divergence:0.0359945
GC content 1 (%):41GC content 2 (%):41GC content divergence:0
Length 1 (bp):3993Length 2 (bp):3981Length divergence:-0.002
MFE 1 (kcal):-1144.32MFE 2 (kcal):-1113.08MFE divergence-0.014