Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G24265-AT1G24267
Species:Arabidopsis
Duplication type:TD
Function (paralog1):Protein of unknown function (DUF1664)
Function (paralog2):Protein of unknown function (DUF1664)

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:1.9690372297494
Log2 mRNA fold difference:2.9710790326788
Log2 TE fold difference:-1.1881526907537
Sequences
Protein sequence

MALPLGKLTILIGAVYLTGSKFKTLLEYSYSLNTSEEKFMFSFSVNAPTSLIGSAFSKEG
GLPDVSNLVSGAFKMVFRQLKQDEPSKSASKPHDDVLVAQVNSLRHEIQLLGSNRPITIV
SPSGSGGRNYGLIIIVGVIGYGYVWWKGWKLPDFMFATRRSLSDACNNVGNQIDGFYSSL
KGTKRELSSEIDMMGRRLDANTEVIQETIQEVAKLQDGTSFIKDDVKAVFDAFENLASKV
CRIEGNQDITLRGVGALHAQCQENQRIQESNKALPSTSSLPALEAAPMAPSSKTLSLPPA
SPDESQSPSTPNVAQKSRGLLQHTQSMSGLKDINESSSSHNTSSNGIYFGGNGASGSSSG
VLGRFSIARIMRTRTVVNTVSTN

MAIPLGKLTILIGAGLVGSVLAKEGSLPDVSSFVSGALKMVFRQLKQEEPAKSASKPRND
TLMAQVNSLRHELSLLSSNRPITIVTTAGSGGKKYGYIIIIGVIGYGYVWWKGWKLPDLM
FATRRSLSDACNSVGSQIDGFYTSLSGTKKELSSKIDGMGRSLDANTEIIQDTGREVMEL
QRGTENIKDDVKFVFDAVENLVRKLIYRIEGNQDITLKGVGALHAQVRENKRIQESNKAL
PSTSAVPALEAAPMTPSSRTLSLPPASPRESQSPSTSNGAQQSRGPLQHTQSMSGLKEIS
ENGTHSGETTGNTSSGLFSIFSIPRIGRTRSVVNTVPTNSIGPQ

www.000webhost.com

Other information
Ka divergence:-0.258805KaKs divergence:0.0251463
GC content 1 (%):43GC content 2 (%):44GC content divergence:0.011
Length 1 (bp):1152Length 2 (bp):1035Length divergence:-0.053
MFE 1 (kcal):-348.62MFE 2 (kcal):-294.41MFE divergence-0.084