Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G24320-AT1G67490
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Six-hairpin glycosidases superfamily protein
Function (paralog2):glucosidase 1

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:2.067954224214
Log2 mRNA fold difference:1.8878263870472
Log2 TE fold difference:0.12205954754348
Sequences
Protein sequence

MTGLSPSGDIKPLLDDESQRPRVITPFPSPKLTDLSMFQGEHKESLYWGTYRPQMYFGVR
ARTPKSLVAGLMWLVMKDGKPVMRHFCENSNDLKSFGWKEHNGRDFGRQELFEQNMVLET
SFVKSEEGSLGYGGDWSIRINVQNMLNDDEVKRSTHLFFYLADEGCNGVNLGKDVLRLKE
SSVLASGSRQDVGNWQMHLKSQNHLETHYCGFKTPDIVNLSGLVQQNLTAQEEKSGLLQL
SDSSEDSSNIYVFQISTTNQSTIDIAFVSGIKEETSNMENRIMSLTGLPLSSLLEEKHIA
FNAKFNECFNLSDKLDPETLVVGKAAIGNMLGGIGYFYGQSKIHFPKSPLAKSEDDFLLY
WPAELYTAVPSRPRFPRGFLWDEGFHQLLIWRWDVHITLEIVGNWLDLMNIDGWIPREQV
LGAEALSKIPKQYVVQFPSNGNPPTLLLVIRDLINGIRTEKFNEADRDKILSFLDRAFVR
LDAWFKWFNTSQIGKEKGSYYWHGRDNITNRELNPQSLSSGLDDYPRASHPNEDERHVDL
RCWMYLAADSMNSIQEFMGKNDILVTEDYSSIAKLLSDFTLLNQMHYDKDHGAYLDFGNH
TEEVRLVWKEVIHEDGHLSRELVRETYGKPELRLVPHIGYVSFFPFMFRIIPADSSILDK
QLDLISNGNIVWSDYGLLSLAKTSSLYMKYNSEHQAPYWRGAIWMNMNYMILSSLHHYST
VDGPYNSKARTIYEELRSNLIRNVVRNYDQTGIIWEHYDQTKGTGEGARVFTGWSALILL
IMSEEYPLF

MTGASRRSARGRIKSSSLSPGSDEGSAYPPSIRRGKGKELVSIGAFKTNLKILVGLIILG
IIVIYFVINRLVRHGLLFDESQKPRVITPFPAPKVMDLSMFQGEHKESLYWGTYRPHVYF
GVRARTPLSLVAGLMWLGVKDEMYVMRHFCENSDDLSTFGWREHNGRDYGRQELVENDMV
IETSFVKSKGDGLGYGGDWAVRIDVKNKGLNDDVKRSAHLFFYLADEGGNVLNLGQDGLD
FQGSSLLVSGSREDVGDWQIHLKSQNQLETHYSGFKTPHIYNLSDLVQQNLALQARKFGR
LQLSDTSEDSSNIYIFQISGRLPFTIDIPFISGIKGESSNVEKRLTSLTGLPLSDLLKKK
HQEFDAKFNECFKLSEKHDSETLGVGRTAIANMLGGIGYFYGQSKIYVPKSTQPGSRDNF
LLYWPAELYTAVPSRPFFPRGFLWDEGFHQLLIWRWDIRITLDIVGHWLDLLNIDGWIPR
EQILGAEALSKVPEEFVVQYPSNGNPPTLFLVIRDLIDAIRMEKFVASEKDEVLSFLERA
SVRLDAWFQWFNTSQKGKEIGSYFWHGRDNTTTQELNPKTLSSGLDDYPRASHPSEDERH
VDLRCWMYLAADCMHSITELLGKEDKLSKENYNSTVKLLSNFNLLNQMHYDSDYGAYFDF
GNHTEKVKLIWKEVIQENGQLSRQLVRKTFGKPKLKLVPHLGYVSFFPFMSRIIPPDSPI
LEKQLDLISNRSILWSDYGLVSLAKTSSMYMKRNTEHDAPYWRGPIWMNMNYMILSSLYH
YSIVDGPYREKSKAIYTELRSNLIRNVVRNYYETGYIWEQYDQVKGTGKGTRLFTGWSAL
TLLIMSEDYPIF

www.000webhost.com

Other information
Ka divergence:-0.327994KaKs divergence:0.235392
GC content 1 (%):41GC content 2 (%):42GC content divergence:0.012
Length 1 (bp):2370Length 2 (bp):2559Length divergence:0.038
MFE 1 (kcal):-711.3MFE 2 (kcal):-762.02MFE divergence0.034