Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G24330-AT1G67530
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):ARM repeat superfamily protein
Function (paralog2):ARM repeat superfamily protein

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:2.1866595494802
Log2 mRNA fold difference:3.3867481811792
Log2 TE fold difference:-1.0070811393049
Sequences
Protein sequence

MDVSELEENLFAASDAKLHGDMCKELSAVYCKVLSIFPSLEEARPRSKSGIQTLCSLHIA
LEKAKNILQHCSECSKLYLAITGDAVLLKFEKAKSALIDSLRRVEDIVPSSIGSQILDIV
GELEHTKFLLDPSEKEVGDRIIALLQQGKKFDNGSDSTELEIFHQAATRLSITSSRSALA
ERRALKKVIDRARVEEDKRKESIVAYLLHLMRKYSKLFRSEMMDENDSPCSTPCSPTGQG
PNEDRVNAFGRQLSKFGSINYKPMNSRKSGQMPIPPEELRCPISLQLMYDPVIIASGQTY
ERVCIEKWFSDGHNSCPKTQQQLPHLSLTPNYCVKGLIASWCEQNGITVPTGPPESLDLN
YWRLAMSDSESPNSKSVDSVGLCTPKDIRVVPLEESSTIESERQQKEKNNAPDEVDSEIN
VLEGYQDILAIVDKEEDLAKKCKVVENVRILLKDNEEARILMGANGFVEAFLQFLESAVH
DNNAAAQETGAMALFNLAVNNNRNKELMLTSGVIPLLEKMISCSQSQGPATALYLNLSCL
EKAKPVIGSSQAVSFFVNLLLQDTKTQCKLDALHALYNLSTYSPNIPTLLSSNIIKSLQV
LASTGNHLWIEKSLAVLLNLASSREGKEEMITTQGMISTLATVLDTGDTVEQEQAVSCLV
ILCTGSESCIQMVLQEGVIPSLVSISVNGSPRGRDKSQKLLMLFREQRHRDQPSPNKEEA
PRKTVSAPMAIPAPVSAPESEVKPLTKSISRRKTMTRPFSFLWKKSHSIHH

MDVTELEENLFAASDAKLHGDMCKELSGVLCKVLSIFPSLEGARPRSKSGIQALCSLHIA
LEKAKNILQHCSECSKLYLAITGDAVLLKFEKAKIALIDGLKRVEDIVPSSIGSQILEIV
GELENTRFMLDPSEKEVGDQIIALLQQGKKFDNCNDNTELEIFHRAATRLSITSSRVALA
ERRALKKLIDRARAEEDKRKESIVAYLLHLMRKCSKLFRSEILDENDSPGSYPCSPNEDH
GSVHGFGRQLSRFGSLNDKPMNSINSGQMPVPPEELRCPISLQLMCDPVIIASGQTYERV
CIEKWFSDGHNTCPKTQQQLPHISLTPNNCVKGLIASWCEQNGTQIPSGPPESQDLDYWR
LALSDSESTKSQSVNSIGSYKLKGVKIVPLEENGTTVVERQNTEESFVSDDDDEEDSDIN
VLERYQDLLAVLNEEEGLEKKCKVVEKIRLLLKDDEEARIFMGANGFVEALLRFLGSAVD
DNNAAAQDSGAMALFNLAVNNNRNKELMLTSGVIRLLEKMISSAESHGSATALYLNLSCL
DEAKSVIGSSQAVPFLVQLLQKEIETQCKLDALHALYNLSTYSPNIPALLSSNIIKSLQG
LLASTGENLWIEKSLAVLLNLASSQEGKDEAVSSQGMISSLATVLDMGDTTEQEQAVSCL
LILCNGRESCIQMVLQEGVIPSLVSISVNGTPRGREKSQKLLMLFREERQQRDQPSSNRD
EPPQKEPARKSLSAPLSVHGSTPASASVQDYEPRVLSKSMSRRKSMARPFSFFWKKSYSV
RE

www.000webhost.com

Other information
Ka divergence:0.0162962KaKs divergence:0.198552
GC content 1 (%):44GC content 2 (%):44GC content divergence:0
Length 1 (bp):2316Length 2 (bp):2349Length divergence:0.007
MFE 1 (kcal):-666.72MFE 2 (kcal):-730.21MFE divergence0.045