Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G24350-AT1G67600
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Acid phosphatase/vanadium-dependent haloperoxidase-related protein
Function (paralog2):Acid phosphatase/vanadium-dependent haloperoxidase-related protein

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-2.1116970487674
Log2 mRNA fold difference:-2.2890187383663
Log2 TE fold difference:0.28039571235437
Sequences
Protein sequence

MEDSTATATSSSSTHYFSIFTNYPLISAVTSFTIAQFIKLFTSWYRERRWDLKQLIGSGG
MPSSHSATVTALAVAIGLQEGFGGSHFAIALILASVVMYDATGVRLHAGRQAEVLNQIVY
ELPAEHPLAESRPLRELLGHTPPQIVTELGEIMSTNRVLKESVVAGGMLGSATAVTGYLF
FRIATS

MEESVASSSSHYISIFTNYPLISAVLAFTIAQFIKFFTSWYKERRWDLKRLVGSGGMPSS
HSATVTALALAVGLQEGFGGSHFAIALVLTTIVMYDATGVRLHAGRQAEVLNQIVYELPA
EHPLAETRPLRELLGHTPPQVIAGGMLGISTAVVGYLVILLAK

Other information
Ka divergence:0.234664KaKs divergence:0.00390795
GC content 1 (%):45GC content 2 (%):43GC content divergence:-0.023
Length 1 (bp):561Length 2 (bp):492Length divergence:-0.066
MFE 1 (kcal):-167.9MFE 2 (kcal):-140.75MFE divergence-0.088