Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G24470-AT1G67730
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):beta-ketoacyl reductase 2
Function (paralog2):beta-ketoacyl reductase 1

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-0.94562373372674
Log2 mRNA fold difference:-3.2583989979738
Log2 TE fold difference:1.987512544243
Sequences
Protein sequence

MQGACISESQPWYLHFVCFIGFLFLLRVLFIPLLKWFTTRFLLTPKRLKRYGSWAMVTGA
TEGIGRAFAHELAKHGLNLILVSRNLSKLESVSDDFQQEFPHIKIKIIPFDFSSEGGYGA
IEEGIKGLEVGILINNVGITYPRAMFFHEVDQLTWTKILRVNLEATTWVTRSLIGPMLHR
RRGAIVNISSGAAVVVPSHPLYAIYAATKAYVDALSRSLHVEYKQFGIDVQCQVPLYVST
RMVSEVAAIDKPSLFVPSPEVYAKAAVAQIGIGSRCSPFWAHSLQWFLVGLVPDNLVDTW
RLSIGLRRRSLS

MEICTYFKSQPTWLLILFVLGSISIFKFIFTLLRSFYIYFLRPSKNLRRYGSWAIITGPT
DGIGKAFAFQLAQKGLNLILVARNPDKLKDVSDSIRSKYSQTQILTVVMDFSGDIDEGVK
RIKESIEGLDVGILINNAGMSYPYAKYFHEVDEELINNLIKINVEGTTKVTQAVLPNMLK
RKKGAIINMGSGAAALIPSYPFYSVYAGAKTYVDQFTKCLHVEYKKSGIDVQCQVPLYVA
TKMTKIRRASFLVASPEGYAKAALRFVGYEAQCTPYWPHALMGAVVSALPESVFESFNIK
RCLQIRKKGLQKDSMKKE

Other information
Ka divergence:0.213633KaKs divergence:0.971707
GC content 1 (%):48GC content 2 (%):41GC content divergence:-0.079
Length 1 (bp):939Length 2 (bp):957Length divergence:0.009
MFE 1 (kcal):-289.22MFE 2 (kcal):-268.69MFE divergence-0.037