Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G24510-AT1G67760
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):TCP-1/cpn60 chaperonin family protein
Function (paralog2):TCP-1/cpn60 chaperonin family protein

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:-4.4136928770165
Log2 mRNA fold difference:-5.463269060063
Log2 TE fold difference:1.1752338317721
Sequences
Protein sequence

MALAFDEFGRPFIILREQDQKTRLRGIDAQKANIAAGKAVARILRSSLGPKGMDKMLQGP
DGDITITNDGATILEQMDVDNQIAKLMVELSRSQDYEIGDGTTGVVVMAGALLEQAERQL
DRGIHPIRIAEGYEMASRVAVEHLERIAQKFEFDVNNYEPLVQTCMTTLSSKIVNRCKRS
LAEIAVKAVLAVADLERRDVNLDLIKVEGKVGGKLEDTELIYGILIDKDMSHPQMPKQIE
DAHIAILTCPFEPPKPKTKHKVDIDTVEKFETLRKQEQQYFDEMVQKCKDVGATLVICQW
GFDDEANHLLMHRNLPAVRWVGGVELELIAIATGGRIVPRFQELTPEKLGKAGVVREKSF
GTTKERMLYIEHCANSKAVTVFIRGGNKMMIEETKRSIHDALCVARNLIRNKSIVYGGGA
AEIACSLAVDAAADKYPGVEQYAIRAFAEALDSVPMALAENSGLQPIETLSAVKSQQIKE
NIPFYGIDCNDVGTNDMREQNVFETLIGKQQQILLATQVVKMILKIDDVISNSEY

MALAFDEFGRPFIILREQDQKTRLKGIDAQKANISAGKAVARILRSSLGPKGMEKKCFKD
LTEMSPYVSFFLLNLISLRSIPMALALNSGLQPIETLSAVKSQQIKERRTFHSTGLIATM

www.000webhost.com

Other information
Ka divergence:0.847817KaKs divergence:0.652522
GC content 1 (%):45GC content 2 (%):45GC content divergence:0
Length 1 (bp):1608Length 2 (bp):363Length divergence:-0.632
MFE 1 (kcal):-498.79MFE 2 (kcal):-109.3MFE divergence-0.641