Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G24600-AT1G67920
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-0.9063060756554
Log2 mRNA fold difference:0.36923167664906
Log2 TE fold difference:-1.4092368210515
Sequences
Protein sequence

MEKKANHGDDVQESVPIIHSQVVKIKREFEKIQHPSLKQPEMPLVFREIMGPRRSRSPLG
LGERERSIPVGN

MENKTDNGNEDGPIIHSQVEKIKKEFEKIRQPSLQQPEMRRVLSEIKRRQRSRSPLGLGE
RSISVGN

www.000webhost.com

Other information
Ka divergence:-0.422533KaKs divergence:-0.257169
GC content 1 (%):49GC content 2 (%):44GC content divergence:-0.054
Length 1 (bp):219Length 2 (bp):204Length divergence:-0.035
MFE 1 (kcal):-56.5MFE 2 (kcal):-49.2MFE divergence-0.069