Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G24764-AT1G68060
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):microtubule-associated proteins 70-2
Function (paralog2):microtubule-associated proteins 70-1

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:1.4025099639877
Log2 mRNA fold difference:1.6817504752211
Log2 TE fold difference:-0.24094611417188
Sequences
Protein sequence

MSDVSGDGDLSATVTEHEVTPQPPVSSATYPSLTVSASYKESSGGKSSSKRRPIRPSFDA
AADNEFITLLHGSDPVKVELNRLENEVRDKDRELGEANAEIKALRLSERQREKAVEELTE
ELTKLDEKLKLTESILESKNLEIKKINEEKKASMAAQFAAEATLRRVHAAQKDDDMPPIE
AILAPLEAELKLARSEIGKLQEDNRALDRLTKSKEAALLEAERTVEAAMAKAAMVDDLQN
KNQELMKQIEICQEENKILDRMHRQKVAEVEKLTQTVRELEEAVLAGGAAANAVRDYQRK
FQEMNEERKTLDRELARAKVTANRVATVVANEWKDGNDKVMPVKQWLEERRFLQGEMQQL
RDKLAITDRAAKSEAQLKEKFQLRLKVLEETLRGTSSSATRNTPEARSMSNGPSRRQSLG
GAENLQKFTSNGALSKKAPASQMRHSLSINSTSVLKNAKGTSKSFDGGTRSVDRGKALLN
GPGNYSFNKATDDSKEAESGNGWKENSEEKPQSEDPEAATEDSVPGVLYDLLQKEVVSLR
KASNEKDQSLKDKDDAIEMLAKKVETLTKAMEVEAKKMRREVAAMEKEVAAMRVEKDQDA
RAKRFSNSKSPSNTAQILAGRAAGRSGGLTKSTQ

MSDVSADGGFLSAEQATTPVAIPTPYPSLTVSASYKEKSSGRRRPVRPSFDAAADNEFIT
LLHGSDPVKVELNRLENEVRDKDRELSEANAEIKALRLSERQREKACEELTDELAKLDGK
LKLTESLLQSKNLEIKKINEEKKASMAAQFAAEATLRRVHAAQKDDDMPPIEAILAPLEA
ELKLARSEIGKLQEDNRALDRLTKSKEAALLDAERTVETALAKAALVDDLQNKNQELMKQ
IEICQEENKILDRMHRQKVAEVEKLTQTVRELEEAVLAGGAAANAVRDYQRKFQEMNEER
KTLDRELARAKVTANRVATVVANEWKDGNDKVMPVKQWLEERRFLQGEMQQLRDKLAISD
RAAKSEAQLKDKFQLRLRVLEETLRGTSSISIRNTPEGRSMSNGPSRRQSIGGSDNLQKF
ASNGFLSKKTPMRNSFTSNSTSVLKNAKGTSKSFDGGTRSLDRGKALLKGPGNYSFNKAC
DETKESESPNTWKEDSEEKPPSELPAPATEDNVPGVLYDLLQKEVVALRKSSHEKDQSLK
DKDDAIEMLAKKVETLTKAMEVEAKKMRREVAAMEKEVAAMRVDKDQDNRAKRSSNTKPS
SNTAQILAARAAGRSGLTRSTQ

Other information
Ka divergence:0.0317233KaKs divergence:-0.276243
GC content 1 (%):45GC content 2 (%):44GC content divergence:-0.011
Length 1 (bp):1905Length 2 (bp):1869Length divergence:-0.01
MFE 1 (kcal):-581.17MFE 2 (kcal):-545.74MFE divergence-0.031