Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G25370-AT1G68340
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Protein of unknown function (DUF1639)
Function (paralog2):Protein of unknown function (DUF1639)

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-0.40840302992184
Log2 mRNA fold difference:-0.52493001797712
Log2 TE fold difference:0.045139550638032
Sequences
Protein sequence

MVFPGEMTTTTTRPEQRSKTLHNFPLPNLWGNQRQLKCTKIDSISNNNNNGGGPGGDHRL
RRRSPPLEFADSPVSMPFRFGNSDHRRPFKSGSEEGIEEFRVKLMSDLKTETDKITQSMF
NKGVTEEEEEQIDGSGSGSGSGQEKEMIPPVKPWNLRKRRAAACKEPESNSLINKGIVIE
EKVVKNPSPVRGGGGVVEAEKKRPMFSMKLSKKEMEEDFIGMVGHRAPRRPKKRSKTVQK
KLDSLFPGLYLTEVTHDAYKVPE

MATTTGHERSKTLINFSLPKLWGTQRLLRCGKGDDSDGDGGEGSSSGGDQRIRRRSSNFE
SDHQNRRLKVESSEKEGIEEFREKIMLDLRNVADKMKESIFRQQVLLGEEEEDKEIEIER
DDSPPEATGAATVEVRPWNLRKRRAACKASISLGIDSKNQCKESVMNPSMLGNELGKDRS
RLLYTLSKKEIEEDYMMMIGLKPPRRPKKRSRTVQKQIDLLNFASYITEITEDLYNVPDQ
AEKRKS

Other information
Ka divergence:0.0235108KaKs divergence:0.207837
GC content 1 (%):48GC content 2 (%):43GC content divergence:-0.055
Length 1 (bp):792Length 2 (bp):741Length divergence:-0.033
MFE 1 (kcal):-237.7MFE 2 (kcal):-213.86MFE divergence-0.053