Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G25400-AT1G68440
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:0.98280284017011
Log2 mRNA fold difference:1.4258774746335
Log2 TE fold difference:-0.55921666283235
Sequences
Protein sequence

MEVPIINRIGDFDMGINSINDPSYLSRALAVSGVGKLHQAYSFWKWGALLLLAFFASFTS
LTTRIKTLVFRLRNVNVSLPSQTLLCNYDSDSDWSFSSDSSDEEKDEDDNKEDDSVNGDS
RVQRFGYYHDDDDKGISGSVPWLRRCSGSFGDLLDLGSSGVVKLWDNLDFNGEGSPVASF
FSKCGSYSLLSSAVLLAAEKKGSDGLEVSAWDARVGFGVPALLAEWKQPGRLLGKIIRVD
VGDVDKIYVGDDVEGEITVGDMRMVNGALTELTESEVERMVRRRRRRH

MEVPVINRIRDFEVGINSINDPSFLSRSVAVSGIGKLHQAYGFWKWGALIIAFLAYFTNF
VSKLNSLVVRLRKIDVSVSSPTLFDDYDSDSDVSCSSTVSSDDEKDEEDEADDEDEDVDS
IFNRRRVNGGFRVRGSDYYDDDDDQGDNGNCTWMGRRYSGSFGDLFSWPDLGGIGSSGVV
KLWDHLDIDGDDHENVVATFLKNYNSTSSPFFWAAEKKGVDAVKVKACDPRAGFRMPALL
AEWRQPGRLLGNIIGVDTGGVEKVYVRDDVSGEIAVGDLRKFNGVLTDLTECEAETWWDA
DVLISG

Other information
Ka divergence:-0.16707KaKs divergence:-0.2135
GC content 1 (%):46GC content 2 (%):45GC content divergence:-0.011
Length 1 (bp):867Length 2 (bp):921Length divergence:0.03
MFE 1 (kcal):-273.5MFE 2 (kcal):-296.3MFE divergence0.04