Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G25440-AT1G68520
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):B-box type zinc finger protein with CCT domain
Function (paralog2):B-box type zinc finger protein with CCT domain

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:1.1043587482086
Log2 mRNA fold difference:1.5442950888334
Log2 TE fold difference:-0.40630741233469
Sequences
Protein sequence

MMKSLANAVGAKTARACDSCVKRRARWYCAADDAFLCQSCDSLVHSANPLARRHERVRLK
TASPAVVKHSNHSSASPPHEVATWHHGFTRKARTPRGSGKKNNSSIFHDLVPDISIEDQT
DNYELEEQLICQVPVLDPLVSEQFLNDVVEPKIEFPMIRSGLMIEEEEDNAESCLNGFFP
TDMELEEFAADVETLLGRGLDTESYAMEELGLSNSEMFKIEKDEIEEEVEEIKAMSMDIF
DDDRKDVDGTVPFELSFDYESSHKTSEEEVMKNVESSGECVVKVKEEEHKNVLMLRLNYD
SVISTWGGQGPPWSSGEPPERDMDISGWPAFSMVENGGESTHQKQYVGGCLPSSGFGDGG
REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRASLAAAASPLGVNY

MMKSLASAVGGKTARACDSCVKRRARWYCAADDAFLCHACDGSVHSANPLARRHERVRLK
SASAGKYRHASPPHQATWHQGFTRKARTPRGGKKSHTMVFHDLVPEMSTEDQAESYEVEE
QLIFEVPVMNSMVEEQCFNQSLEKQNEFPMMPLSFKSSDEEDDDNAESCLNGLFPTDMEL
AQFTADVETLLGGGDREFHSIEELGLGEMLKIEKEEVEEEGVVTREVHDQDEGDETSPFE
ISFDYEYTHKTTFDEGEEDEKEDVMKNVMEMGVNEMSGGIKEEKKEKALMLRLDYESVIS
TWGGQGIPWTARVPSEIDLDMVCFPTHTMGESGAEAHHHNHFRGLGLHLGDAGDGGREAR
VSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRSSIGVAH

www.000webhost.com

Other information
Ka divergence:0.21163KaKs divergence:0.385985
GC content 1 (%):47GC content 2 (%):49GC content divergence:0.021
Length 1 (bp):1254Length 2 (bp):1221Length divergence:-0.013
MFE 1 (kcal):-399MFE 2 (kcal):-402.52MFE divergence0.004