Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G25450-AT1G68530
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):3-ketoacyl-CoA synthase 5
Function (paralog2):3-ketoacyl-CoA synthase 6

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:2.8910724748315
Log2 mRNA fold difference:3.2890782750846
Log2 TE fold difference:-0.31408016716224
Sequences
Protein sequence

MSDFSSSVKLKYVKLGYQYLINNFLTLLLIPVIATVAIELLRMGPEEILSVLNSLHFELL
HILCSSFLIIFVSTVYFMSKPRTVYLVDYSCYKPPVTCRVPFSSFMEHSRLILKDNPKSV
EFQMRILERSGLGEETCLPPAIHYIPPTPTMESARNEAQMVIFTAMEDLFKNTGLKPKDI
DILIVNCSLFSPTPSLSAMIINKYKLRSNIKSYNLSGMGCSASLISVDVARDLLQVHPNS
NAIIISTEIITPNYYKGNERAMLLPNCLFRMGGAAILLSNRRSDRWRAKYKLCHLVRTHR
GADDKSYNCVMEQEDKNGNVGINLSKDLMTIAGEALKANITTIGPLVLPASEQLLFLSSL
IGRKIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSGEHVEASRMTLHRFGN
TSSSSLWYELSYIEAQGRMKRNDRVWQIAFGSGFKCNSAVWKCNRTIKTPTDGAWSDCIE
RYPVFIPEVVKL

MPQAPMPEFSSSVKLKYVKLGYQYLVNHFLSFLLIPIMAIVAVELLRMGPEEILNVWNSL
QFDLVQVLCSSFFVIFISTVYFMSKPRTIYLVDYSCYKPPVTCRVPFATFMEHSRLILKD
KPKSVEFQMRILERSGLGEETCLPPAIHYIPPTPTMDAARSEAQMVIFEAMDDLFKKTGL
KPKDVDILIVNCSLFSPTPSLSAMVINKYKLRSNIKSFNLSGMGCSAGLISVDLARDLLQ
VHPNSNAIIVSTEIITPNYYQGNERAMLLPNCLFRMGAAAIHMSNRRSDRWRAKYKLSHL
VRTHRGADDKSFYCVYEQEDKEGHVGINLSKDLMAIAGEALKANITTIGPLVLPASEQLL
FLTSLIGRKIFNPKWKPYIPDFKLAFEHFCIHAGGRAVIDELQKNLQLSGEHVEASRMTL
HRFGNTSSSSLWYELSYIESKGRMRRGDRVWQIAFGSGFKCNSAVWKCNRTIKTPKDGPW
SDCIDRYPVFIPEVVKL

www.000webhost.com

Other information
Ka divergence:-0.157792KaKs divergence:-0.999963
GC content 1 (%):45GC content 2 (%):48GC content divergence:0.032
Length 1 (bp):1479Length 2 (bp):1494Length divergence:0.005
MFE 1 (kcal):-410.13MFE 2 (kcal):-464.41MFE divergence0.062