Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G25470-AT1G68550
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):AP2 domain-containing transcription factor family protein
Function (paralog2):Integrase-type DNA-binding superfamily protein

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:1.2384524830127
Log2 mRNA fold difference:1.3197570338277
Log2 TE fold difference:-0.086466967195962
Sequences
Protein sequence

MKSFVKPERDSLLRTVRIVFTDPDATDDSSSSSDEWLPKPRKVKRFVHEITFLPQVSESS
QDRSNAVKTPRRKSTRQFKYPVGVRPRPSGKFAAEILNPFTKTKKWLGTYETPAEAEKAY
VDKKVEYDALASSGSAVSSSVVTVTSQCLRSPTSASVSCVSADDLSKEKTSLNKDVAASG
DSTTKEVFTTFDFSDVKIPDLRFLAAEEDSMVSNANGAELDFDCFLTDSNILLDDYSLLE
NDINFSRFENSLPSELPDCDFTEMEFQLDDFKFAYTDHLTTPPLGLV

MVAIRKEQSLSGVSSEIKKRAKRNTLSSLPQETQPLRKVRIIVNDPYATDDSSSDEEELK
VPKPRKMKRIVREINFPSMEVSEQPSESSSQDSTKTDGKIAVSASPAVPRKKPVGVRQRK
WGKWAAEIRDPIKKTRTWLGTFDTLEEAAKAYDAKKLEFDAIVAGNVSTTKRDVSSSETS
QCSRSSPVVPVEQDDTSASALTCVNNPDDVSTVAPTAPTPNVPAGGNKETLFDFDFTNLQ
IPDFGFLAEEQQDLDFDCFLADDQFDDFGLLDDIQGFEDNGPSALPDFDFADVEDLQLAD
SSFGFLDQLAPINISCPLKSFAAS

www.000webhost.com

Other information
Ka divergence:-0.192776KaKs divergence:-0.465407
GC content 1 (%):42GC content 2 (%):42GC content divergence:0
Length 1 (bp):864Length 2 (bp):975Length divergence:0.06
MFE 1 (kcal):-244.81MFE 2 (kcal):-278MFE divergence0.063