Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G25520-AT1G68650
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Uncharacterized protein family (UPF0016)
Function (paralog2):Uncharacterized protein family (UPF0016)

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-0.19352220924567
Log2 mRNA fold difference:-1.1752440051811
Log2 TE fold difference:0.95048104607327
Sequences
Protein sequence

MSSVLQGFTKSLAMTFVSEIGDKTFFAAAILAMRYPRRLVLAGCLSALIVMTILSATLGW
AAPNLISRKWTHHITTLLFFGFGLWSLWDGFKEGGGGSEELAEVEAELDADLKANGKSPK
DSSKREDENKKQNRAFLTQFFSPIFLKAFSINFFGEWGDKSQLATIGLAADENPFGVVLG
GVVAQFLCTTAAVIGGKSLASQISERIVALSGGMLFIIFGIQSYLTSVEA

MGSLLQGFTKSLAMTFLSEIGDKTFFAAAILAMRYPRRLVLAGCLSALIVMTILSATLGW
AAPNLISRKWTHHITTFLFFGFGLWSLWDGFKEGGGSEELAEVEAELDSDLKKTNDQSKN
SKIEDEQKKQKRPFLTAFFSPIFLKAFSINFFGEWGDKSQLATIGLAADENPLGVVLGGI
VAQTLCTTAAVLGGKSLASQISERIVALSGGMLFIIFGIQSLLTPVDA

Other information
Ka divergence:0.154137KaKs divergence:-0.652121
GC content 1 (%):43GC content 2 (%):43GC content divergence:0
Length 1 (bp):693Length 2 (bp):687Length divergence:-0.004
MFE 1 (kcal):-202.22MFE 2 (kcal):-191.31MFE divergence-0.028