Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G25550-AT1G68670
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):myb-like transcription factor family protein
Function (paralog2):myb-like transcription factor family protein

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:-0.23104299150053
Log2 mRNA fold difference:-0.86556464641777
Log2 TE fold difference:0.64559588843737
Sequences
Protein sequence

MMMFKSGDMDYTQKMKRCHEYVEALEEEQKKIQVFQRELPLCLELVTQAIESCRKELSES
SEHVGGQSECSERTTSECGGAVFEEFMPIKWSSASSDETDKDEEAEKTEMMTNENNDGDK
KKSDWLRSVQLWNQSPDPQPNNKKPMVIEVKRSAGAFQPFQKEKPKAADSQPLIKAITPT
STTTTSSTAETVGGGKEFEEQKQSHSNRKQRRCWSPELHRRFLHALQQLGGSHVATPKQI
RDLMKVDGLTNDEVKSHLQKYRLHTRRPATPVVRTGGENPQQRQFMVMEGIWVPSHDTTN
NRVYAPVATQPPQSSTSGERSNRGCKSPATSSTTTHTPHLLPLS

MMVEMDYAKKMQKCHEYVEALEEEQKKIQVFQRELPLCLELVTQAIEACRKELSGTTTTT
SEQCSEQTTSVCGGPVFEEFIPIKKISSLCEEVQEEEEEDGEHESSPELVNNKKSDWLRS
VQLWNHSPDLNPKEERVAKKAKVVEVKPKSGAFQPFQKRVLETDLQPAVKVASSMPATTT
SSTTETCGGKSDLIKAGDEERRIEQQQSQSHTHRKQRRCWSPELHRRFLNALQQLGGSHV
ATPKQIRDHMKVDGLTNDEVKSHLQKYRLHTRRPAATSVAAQSTGNQQQPQFVVVGGIWV
PSSQDFPPPSDVANKGGVYAPVAVAQSPKRSLERSCNSPAASSSTNTNTSTPVS

www.000webhost.com

Other information
Ka divergence:-0.0263878KaKs divergence:-0.117181
GC content 1 (%):43GC content 2 (%):45GC content divergence:0.023
Length 1 (bp):1035Length 2 (bp):1065Length divergence:0.014
MFE 1 (kcal):-286.7MFE 2 (kcal):-314.02MFE divergence0.045