Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G25560-AT1G68840
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):AP2/B3 transcription factor family protein
Function (paralog2):related to ABI3/VP1 2

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:0.48663580766692
Log2 mRNA fold difference:0.52415474916909
Log2 TE fold difference:0.025520584609161
Sequences
Protein sequence

MEYSCVDDSSTTSESLSISTTPKPTTTTEKKLSSPPATSMRLYRMGSGGSSVVLDSENGV
ETESRKLPSSKYKGVVPQPNGRWGAQIYEKHQRVWLGTFNEEEEAASSYDIAVRRFRGRD
AVTNFKSQVDGNDAESAFLDAHSKAEIVDMLRKHTYADEFEQSRRKFVNGDGKRSGLETA
TYGNDAVLRAREVLFEKTVTPSDVGKLNRLVIPKQHAEKHFPLPAMTTAMGMNPSPTKGV
LINLEDRTGKVWRFRYSYWNSSQSYVLTKGWSRFVKEKNLRAGDVVCFERSTGPDRQLYI
HWKVRSSPVQTVVRLFGVNIFNVSNEKPNDVAVECVGKKRSREDDLFSLGCSKKQAIINI
L

MDSSCIDEISSSTSESFSATTAKKLSPPPAAALRLYRMGSGGSSVVLDPENGLETESRKL
PSSKYKGVVPQPNGRWGAQIYEKHQRVWLGTFNEQEEAARSYDIAACRFRGRDAVVNFKN
VLEDGDLAFLEAHSKAEIVDMLRKHTYADELEQNNKRQLFLSVDANGKRNGSSTTQNDKV
LKTREVLFEKAVTPSDVGKLNRLVIPKQHAEKHFPLPSPSPAVTKGVLINFEDVNGKVWR
FRYSYWNSSQSYVLTKGWSRFVKEKNLRAGDVVTFERSTGLERQLYIDWKVRSGPRENPV
QVVVRLFGVDIFNVTTVKPNDVVAVCGGKRSRDVDDMFALRCSKKQAIINAL

www.000webhost.com

Other information
Ka divergence:-0.0447924KaKs divergence:0.227836
GC content 1 (%):50GC content 2 (%):49GC content divergence:-0.01
Length 1 (bp):1086Length 2 (bp):1059Length divergence:-0.013
MFE 1 (kcal):-393.33MFE 2 (kcal):-360.71MFE divergence-0.043