Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G25682-AT1G25988
Species:Arabidopsis
Duplication type:TD
Function (paralog1):Family of unknown function (DUF572)
Function (paralog2):Family of unknown function (DUF572)

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-1.0378526774427
Log2 mRNA fold difference:-0.84544859548769
Log2 TE fold difference:-0.12099294877837
Sequences
Protein sequence

MSTLSAARADNFYYPPEWTPDQGSLNKFQGQHPLRERAKKIGEGILVIRFEMPYNIWCGG
CSSMIAKGVRFNAEKKQVGNYYSTKIWSFAMKSPCCKHEIVIQTDPQNCEYVITSGAQKK
VEEYEAEDAETMELTAEQEKGKLADPFYRLEHQEVDLQKKKAAEPLLVRLQRVSDARHAD
DYSLNKALRAQLRRHRKRVAEEETASRKLGLGIRLLPKSEEDIKAASNVKFKSKFDKNRK
DKRALIHASSIFPESSYSSSKKRMELEAKRRKISAASASSLLRGGFKASSLSTNPSASKP
KVSSVSVRKL

MADNFNYPPDWTPNQSKENRRGNFGHKTDPQNCEYVITSGAQKKVEEYEAEDAETMELTA
EQEKGKLADPFYRLEHQEVDLQKKKAAEPFLVRLQRVSDARHADGTQKTCSRRRGCFKEA
RLGEKSDFFERVKKILRLPQTLLGVIIEQEKNGAGRKEKENNRSISIKSTEGRIQSFSIV

Other information
Ka divergence:0.84945KaKs divergence:0.220817
GC content 1 (%):43GC content 2 (%):45GC content divergence:0.023
Length 1 (bp):933Length 2 (bp):543Length divergence:-0.264
MFE 1 (kcal):-257.79MFE 2 (kcal):-145.16MFE divergence-0.28