Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G26130-AT1G68710
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):ATPase E1-E2 type family protein / haloacid dehalogenase-like hydrolase family protein
Function (paralog2):ATPase E1-E2 type family protein / haloacid dehalogenase-like hydrolase family protein

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:0.91291460967436
Log2 mRNA fold difference:1.1340199683915
Log2 TE fold difference:-0.31253572818674
Sequences
Protein sequence

MATVSGRRRKRKIQLSKLFTLTGAKACFKPDHSKIGRSGFSRVVFCNQPDSPEAESRNYC
DNYVRTTKYTLATFLPKSLFEQFRRVANFYFLVVGILSFTPLAPYTAVSAIVPLTFVILA
TMFKEGVEDWRRKQQDIEVNNRKVRVHRGNGNFDLREWKTLRVGDILKVEKNEFFPADLV
LLSSSYEDAVCYVETMNLDGETNLKLKQGLEVTLSLREELNFRDFEAFIKCEDPNANLYS
FVGTMDLKGEKYPLSPQQLLLRGSKLRNTDYIYGVVIFTGPDTKVVQNSTDPPSKRSMIE
RKMDKIIYLMFLMVFSLAFFGSVLFGIWTRDDFQNGVMERWYLKPDDSSIFFDPKRAPMA
AIYHFLTALMLNSYFIPISLYVSIEIVKVLQSIFINQDIHMYYEEADKPAHARTSNLNEE
LGQVGTILSDKTGTLTCNSMEFIKCSIAGTAYGRGVTEVEMAMDKRKGSALVNQSNGNST
EDAVAAEPAVKGFNFRDERIMDGNWVTETHADVIQKFFQLLAVCHTVIPEVDEDTGKISY
EAESPDEAAFVIAARELGFEFFTRTQTTISVRELDLVTGERVERLYSVLNVLEFSSSKKR
MSVIVQDQDGKLLLLCKGADSVMFERLSESGRKYEKETRDHVNEYADAGLRTLILAYREL
DENEYEVFTERISEAKNSVSADREALIDEVTEKIEKNLVLLGATAVEDKLQNGVPDCINK
LAQAGIKIWVLTGDKMETAINIGFACSLLRRDMKQIIINLETPEIQQLEKSGEKDAIAAA
LKENVLHQITSGKAQLKASGGNAKAFALIIDGKSLAYALEEDMKGIFLELAIGCASVICC
RSSPKQKALVTRLVKTGSGQTTLAIGDGANDVGMLQEADIGVGISGVEGMQAVMSSDIAI
AQFRYLERLLLVHGHWCYRRISKMICYFFYKNITFGFTLFLYEAYTSFSATPAYNDWYLS
LYSVFFTSLPVICLGIFDQDVSAPFCLKFPVLYQEGVQNLLFSWRRILSWMFHGFCSAII
IFFLCKTSLESQAFNHEGKTAGRDILGGTMYTCVVWVVSLQMVLTISYFTLIQHVVVWGS
VVIWYLFLMVYGSLPIRMSTDAYMVFLEALAPAPSYWITTLFVVLSTMMPYFIFSAIQMR
FFPMSHGTVQLLRYEDQCSNSGNFEMGRQGSVRPTLVMRSHQPES

MVGGGTKRRRRRLQLSKLYTLTCAQACFKQDHSQIGGPGFSRVVYCNEPDSPEADSRNYS
DNYVRTTKYTLATFLPKSLFEQFRRVANFYFLVTGVLAFTPLAPYTASSAIVPLLFVIGA
TMVKEGVEDWRRQKQDNEVNNRKVKVHRGDGSFDAKEWKTLSIGDIVKVEKNEFFPADLV
LLSSSYEDAICYVETMNLDGETNLKVKQGLEVTSSLRDEFNFKGFEAFVKCEDPNANLYS
FVGTMELKGAKYPLSPQQLLLRDSKLRNTDFIFGAVIFTGHDTKVIQNSTDPPSKRSMIE
KKMDKIIYLMFFMVITMAFIGSVIFGVTTRDDLKDGVMKRWYLRPDSSSIFFDPKRAPVA
AIYHFLTAVMLYSYFIPISLYVSIEIVKVLQSIFINQDIHMYYEEADKPARARTSNLNEE
LGQVDTILSDKTGTLTCNSMEFIKCSVAGTAYGRGVTEVEMAMGRRKGGPLVFQSDENDI
DMEYSKEAITEESTVKGFNFRDERIMNGNWVTETHADVIQKFFRLLAVCHTVIPEVDEDT
EKISYEAESPDEAAFVIAARELGFEFFNRTQTTISVRELDLVSGKRVERLYKVLNVLEFN
STRKRMSVIVQEEDGKLLLLCKGADNVMFERLSKNGREFEEETRDHVNEYADAGLRTLIL
AYRELDEKEYKVFNERISEAKSSVSADRESLIEEVTEKIEKDLILLGATAVEDKLQNGVP
DCIDKLAQAGIKIWVLTGDKMETAINIGFACSLLRQDMKQIIINLETPEIQSLEKTGEKD
VIAKASKENVLSQIINGKTQLKYSGGNAFALIIDGKSLAYALDDDIKHIFLELAVSCASV
ICCRSSPKQKALVTRLVKSGNGKTTLAIGDGANDVGMLQEADIGVGISGVEGMQAVMSSD
IAIAQFRYLERLLLVHGHWCYRRISTMICYFFYKNITFGFTLFLYETYTTFSSTPAYNDW
FLSLYNVFFSSLPVIALGVFDQDVSARYCLKFPLLYQEGVQNVLFSWRRILGWMFNGFYS
AVIIFFLCKSSLQSQAFNHDGKTPGREILGGTMYTCIVWVVNLQMALAISYFTLIQHIVI
WSSIVVWYFFITVYGELPSRISTGAYKVFVEALAPSLSYWLITLFVVVATLMPYFIYSAL
QMSFFPMYHGMIQWLRYEGQCNDPEYCDIVRQRSIRPTTVGFTARLEAKKRSVRISEPAS

www.000webhost.com

Other information
Ka divergence:-0.286237KaKs divergence:-0.249599
GC content 1 (%):43GC content 2 (%):40GC content divergence:-0.036
Length 1 (bp):3558Length 2 (bp):3603Length divergence:0.006
MFE 1 (kcal):-1096.23MFE 2 (kcal):-1060.76MFE divergence-0.016