Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G26150-AT1G68690
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):proline-rich extensin-like receptor kinase 10
Function (paralog2):Protein kinase superfamily protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-2.3101720757139
Log2 mRNA fold difference:0.47598040197914
Log2 TE fold difference:-2.6705456886317
Sequences
Protein sequence

MTTPAQAPREEVSLSPSLASPPLMALPPPQPSFPGDNATSPTREPTNGNPPETTNTPAQS
SPPPETPLSSPPPEPSPPSPSLTGPPPTTIPVSPPPEPSPPPPLPTEAPPPANPVSSPPP
ESSPPPPPPTEAPPTTPITSPSPPTNPPPPPESPPSLPAPDPPSNPLPPPKLVPPSHSPP
RHLPSPPASEIPPPPRHLPSPPASERPSTPPSDSEHPSPPPPGHPKRREQPPPPGSKRPT
PSPPSPSDSKRPVHPSPPSPPEETLPPPKPSPDPLPSNSSSPPTLLPPSSVVSPPSPPRK
SVSGPDNPSPNNPTPVTDNSSSSGISIAAVVGVSIGVALVLLTLIGVVVCCLKKRKKRLS
TIGGGYVMPTPMESSSPRSDSALLKTQSSAPLVGNRSSNRTYLSQSEPGGFGQSRELFSY
EELVIATNGFSDENLLGEGGFGRVYKGVLPDERVVAVKQLKIGGGQGDREFKAEVDTISR
VHHRNLLSMVGYCISENRRLLIYDYVPNNNLYFHLHAAGTPGLDWATRVKIAAGAARGLA
YLHEDCHPRIIHRDIKSSNILLENNFHALVSDFGLAKLALDCNTHITTRVMGTFGYMAPE
YASSGKLTEKSDVFSFGVVLLELITGRKPVDASQPLGDESLVEWARPLLSNATETEEFTA
LADPKLGRNYVGVEMFRMIEAAAACIRHSATKRPRMSQIVRAFDSLAEEDLTNGMRLGES
EIINSAQQSAEIRLFRRMAFGSQNYSTDSLTRNSYISKDENL

MATTPVQPPVSNSPPVTSPPPPLNNATSPATPPPVTSPLPPSAPPPNRAPPPPPPVTTSP
PPVANGAPPPPLPKPPESSSPPPQPVIPSPPPSTSPPPQPVIPSPPPSASPPPALVPPLP
SSPPPPASVPPPRPSPSPPILVRSPPPSVRPIQSPPPPPSDRPTQSPPPPSPPSPPSERP
TQSPPSPPSERPTQSPPPPSPPSPPSDRPSQSPPPPPEDTKPQPPRRSPNSPPPTFSSPP
RSPPEILVPGSNNPSQNNPTLRPPLDAPNSTNNSGIGTGAVVGISVAVALVVFTLFGIFV
WCLRKREKRLSAVSGGDVTPSPMSSTARSDSAFFRMQSSAPVGASKRSGSYQSQSGGLGN
SKALFSYEELVKATNGFSQENLLGEGGFGCVYKGILPDGRVVAVKQLKIGGGQGDREFKA
EVETLSRIHHRHLVSIVGHCISGDRRLLIYDYVSNNDLYFHLHGEKSVLDWATRVKIAAG
AARGLAYLHEDCHPRIIHRDIKSSNILLEDNFDARVSDFGLARLALDCNTHITTRVIGTF
GYMAPEYASSGKLTEKSDVFSFGVVLLELITGRKPVDTSQPLGDESLVEWARPLISHAIE
TEEFDSLADPKLGGNYVESEMFRMIEAAGACVRHLATKRPRMGQIVRAFESLAAEDLTNG
MRLGESEVFNSAQQSAEIRLFRRMAFGSQNYSTDFFSHSSYNSRDANV

www.000webhost.com

Other information
Ka divergence:-0.125214KaKs divergence:-0.120902
GC content 1 (%):48GC content 2 (%):47GC content divergence:-0.011
Length 1 (bp):2289Length 2 (bp):2127Length divergence:-0.037
MFE 1 (kcal):-596.73MFE 2 (kcal):-579.92MFE divergence-0.014