Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G26260-AT1G68920
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):cryptochrome-interacting basic-helix-loop-helix 5
Function (paralog2):basic helix-loop-helix (bHLH) DNA-binding superfamily protein

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:2.1491228367073
Log2 mRNA fold difference:2.4812021060184
Log2 TE fold difference:-0.20314211660508
Sequences
Protein sequence

MSDKDEFAAKKKDLVNTPVDLYPPENPMLGPSPMMDSFRETLWHDGGFNVHTDADTSFRG
NNNIDIPLEMGWNMAQFPADSGFIERAAKFSFFGCGEMMMNQQQSSLGVPDSTGLFLQDT
QIPSGSKLDNGPLTDASKLVKERSINNVSEDSQSSGGNGHDDAKCGQTSSKGFSSKKRKR
IGKDCEEEEDKKQKDEQSPTSNANKTNSEKQPSDSLKDGYIHMRARRGQATNSHSLAERV
RREKISERMKFLQDLVPGCDKVTGKAVMLDEIINYVQSLQCQIEFLSMKLSAVNPVLDFN
LESLLAKDALQSSAPTFPHNMSMLYPPVSYLSQTGFMQPNISSMSLLSGGLKRQETHGYE
SDHHNLVHMNHETGTAPDHEDTTADMKVEP

MDLSAKDEFSAEKRNPDNYDSVNNPSGDWRVDSYPSENLISAGPASCSPSQMMDSFGQTL
WYDPTSVQAVGYAGFNGGNASSSSFRGSIDRSLEMGWNLPNLLPPKGNGLFLPNASSFLP
PSMAQFPADSGFIERAARFSLFSGGNFSDMVNQPLGNSEAIGLFLQGGGTMQGQCQSNEL
NVGEPHNDVSVAVKESTVRSSEQAKPNVPGSGNVSEDTQSSGGNGQKGRETSSNTKKRKR
NGQKNSEAAQSHRSQQSEEEPDNNGDEKRNDEQSPNSPGKKSNSGKQQGKQSSDPPKDGY
IHVRARRGQATNSHSLAERVRREKISERMKFLQDLVPGCNKVTGKAVMLDEIINYVQSLQ
RQVEFLSMKLATVNPQMDFNLEGLLAKDALQLRAGSSSTTPFPPNMSMAYPPLPHGFMQQ
TLSSIGRTITSPLSPMNGGFKRQETNGWEGDLQNVIHINYGAGDVTPDPQAAATASLPAA
NMKVEP

www.000webhost.com

Other information
Ka divergence:-0.26559KaKs divergence:-0.218041
GC content 1 (%):41GC content 2 (%):43GC content divergence:0.024
Length 1 (bp):1173Length 2 (bp):1461Length divergence:0.109
MFE 1 (kcal):-322.47MFE 2 (kcal):-414.01MFE divergence0.124