Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G26300-AT1G69030
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):BSD domain-containing protein
Function (paralog2):BSD domain-containing protein

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:1.426351916286
Log2 mRNA fold difference:0.13672083505811
Log2 TE fold difference:1.2231035340021
Sequences
Protein sequence

MEDLWKRAKSFAEEAGKKSQTITQSSSATFVNLVTETAKKSKELALEASKKADQFNAADF
VAETAKKSKEFAAEASKKADQFKVAALKQADQIQNIKSIADIIGTGTGSGSGSEAELLEF
GVTDDLREFAEGLTSATFQAFPDQDQGDEVSDVITNASNVRKDLSDWQERHATLVLTSVK
QISKLRYELCPRFMKERRFWRIYFTLVSTHVSPYERKYMEELKTKGEHGNEEAKKAPATG
ETETVEKNVAIRRTSTASSEQDLDTFLLGDLEDSDEAPDDGDGSLEDDFDKIGNSDVEDE
KQSSKATTNAGNEVSC

MEDLWKRAKSFAEEAAKKSQTITLQSSSTTFVNLVTETAKKSKEFALEASKKADSINVSE
FVAETAKKSKEFAAEVSTKADQLKVVALKQADQIQNIKSIADIIPGGLGGSGSGGGGSEI
SESELVSFGITDDLREFVKGLTSATFQAFPEQDESSEVSDLETSASNVRKDLSEWQERHA
TLVLGSVKQISKLRYELCPRVMKERRFWRIYFTLVSTHVAPYERKYMEELRNKAESKDEE
AKKSPGLGRTESAEKNRISTASSEQDLDTFLLGDLEDSDEAPDDGDGDDGGSLGDDDFDK
IGNSDVEEEKESNAAKN

Other information
Ka divergence:-0.192223KaKs divergence:-0.21386
GC content 1 (%):45GC content 2 (%):42GC content divergence:-0.034
Length 1 (bp):951Length 2 (bp):954Length divergence:0.002
MFE 1 (kcal):-281.81MFE 2 (kcal):-270.25MFE divergence-0.021