Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G26360-AT1G69240
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):methyl esterase 13
Function (paralog2):methyl esterase 15

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:0.68734003841544
Log2 mRNA fold difference:1.3397138374116
Log2 TE fold difference:-0.6110479287146
Sequences
Protein sequence

MGNSFTCISHEQEQRPKKSSGGGGNNSGKYKYVRRLSLMPSFRRRTLLPSLSCSGSSSTS
SSKKGGIKAKTKKIRERHHHHHQDHEKDSHIIQEQTLAATNLLFNQTPRNSNSVVPPSFR
RSTSVVYPSAQPSGTSSGPVSAVQTPKKSSAGFVRSSSSRQRSSTDPMIKPNQLVDKELN
KVEGSETKRFVLVHGGGFGAWCWYKTITLLEKHGFQVDAVELTGSGVSSIDTNNITSLAH
YSKPLLHFFESLKPTEKVILVGHDFGGACMSYAMEMFPTKIAKAVFISAAMLANGQSTLD
LFNQQLGSNDLMQQAQIFLYANGKKNPPTAVDFDRSLLRDFLFNQSPPKDLALASVSIRP
IPFAPVSEKVHVSEKNYGSIRRFYIKTMEDYAVPVLLQEAMIKLNPPEQVFQLKGSDHAP
FFSRPQSLNKILVEISQIPFKKSS

MGNSLRCISQEQDPNQKKPSSVVNGNSSEKHVRRLSLIPSFRRRTLLPSLSCSGSSTSST
SKKGGIKTKKKIRERHHQEQHHHDHEKDSLIQDQTLAATNILFSQTPRNSNSAPPFRRST
SVVYTQPPTAAVAASVGSVSGALTPKKSTYGYVRSSSNRQRSSTDPVLKPNQLLDKELKV
EGAETKRFVLVHGGGFGAWCWYKTITLLEKHGFQVDAVDLTGSGVSSFDTNNITSLAQYV
KPLLHFFDTLKPTEKVILVGHDFGGACMSYAMEMYPSKIAKAIFISAAMLANAQSTLDLF
NQQPDSNYDLMEQVHLFLYANGKKNPPTAVDFDRSLLRDFFFNQSPPKDVALASVSMRPI
PFAPVVEKLHVSEKNYGSIRRFYIKTMEDDYAVPVSLQDAMIKSNPPEQVFHLKGSDHAP
FFSRPQSLNRILVEISQLPPKKSS

www.000webhost.com

Other information
Ka divergence:0.263424KaKs divergence:0.434933
GC content 1 (%):47GC content 2 (%):45GC content divergence:-0.022
Length 1 (bp):1335Length 2 (bp):1335Length divergence:0
MFE 1 (kcal):-405.3MFE 2 (kcal):-384.52MFE divergence-0.026