Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G26380-AT1G26390
Species:Arabidopsis
Duplication type:TD
Function (paralog1):FAD-binding Berberine family protein
Function (paralog2):FAD-binding Berberine family protein

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-2.9279459041169
Log2 mRNA fold difference:-3.821141961727
Log2 TE fold difference:1.4520899632942
Sequences
Protein sequence

MKEALFGLYLVLLVSGLEAAVTKPNSGNFIECLRYQASPENPITDAIFTVDNTTTFLSSY
VSYTKNTRFSNPNNKNLLAIVVAKDVSHVQATVVCAKSNGIQIRIRSGGHDNEGLSYVSS
VPFVILDMHKLRDITVDVSSKKAWVQAGATLGELYVKIDEASQTLAFPAGICATVGAGGH
ISGGGYGNLMRKFGTTVDHVIDAELVDVNGKLLNRSTMGEDLFWAIRGGGGASFGVILSW
KINLVEVPKIFTVFQVNKTLEQGGTDVVYKWQLVANKFPDNLFLRAMPQVVNGTKHGERT
IAIVFWAQFLGRTDELMEIMNQSFPELGLRREDCQEMSWLNTTLFWAMLPAGTPKTVLLG
RPTDPVFFKSKSDYVKKPIPKEGLEKIWKTMLKFNNIVWLHFNPYGGMMDRIPSNATAFP
HRKGNLFKVQYYTTWLDPNATESNLSIMKELYEVAEPYVSSNPREAFFNYRDIDIGSNPS
GETDVDEAKIYGYKYFLGNLKRLMDVKAKSDPENFFKNEQSIPPLLSRVRRDDEL

MKGTLSVLCLVLLVSVLEAAVTKPKFGDFIGCLRYRTSPENPITDAISFADNTTTFLSSY
VSYTKNKRFSTPNYRKLLAIVAAKHVSHVQATVVCAKSNGIQLRIRSGGHDYEGLSYMSS
VPFVILDMYNLRSITVDVSSKKAWIQAGATLGELYTNVNDVSQTLAFPAGVCATVGAGGH
ISGGGYGNLMRKYGITVDHVIDAQIIDVNGKLLNRATMGEDLFWAIRGGGGGSFGVILSW
KINLVDVPKIVTVFKVNKTLEQGGTDVLYKWQLVASKFPESLFVRAMPQVANGTKRGERT
ITVVFYAQFLGRTDALMAIMNQNWPELGLKHEDCQEMSWLNSTLFWADYPAGTPTSILLD
RPSSPGDFFKSKSDYVKKPIPKEGLEKLWKTMLKFNNNIVWMQFNPYGGVMDRIPATATA
FPHRKGNLFKIQYFTTWFNANATMSSLSQMKELYEVAEPYVSSNPREAFFNYRDIDVGSN
PSGETNVDEAKIYGSKYFLGNLKRLMDVKAKYDPDNFFKNEQSIPPVRVM

www.000webhost.com

Other information
Ka divergence:-0.0104801KaKs divergence:0.653764
GC content 1 (%):45GC content 2 (%):44GC content divergence:-0.011
Length 1 (bp):1608Length 2 (bp):1593Length divergence:-0.005
MFE 1 (kcal):-484.94MFE 2 (kcal):-490.8MFE divergence0.006