Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G26600-AT1G69320
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):CLAVATA3/ESR-RELATED 9
Function (paralog2):CLAVATA3/ESR-RELATED 10

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-1.3105114724338
Log2 mRNA fold difference:-0.41629194048966
Log2 TE fold difference:-0.93942326371092
Sequences
Protein sequence

MTMTHLNRLILISLLFVSLLLKSSTASSTVVDEGNRTSRNFRYRTHRFVPRFNHHPYHVT
PHRSCDSFIRPYARSMCIELQRIHRSSRKQPLLSPPPPEIDPRYGVDKRLVPSGPNPLHN

MKTNRNRPINILIVFFLLTTARAATRNWTNRTHRTVPKVQHAYYAYPHRSCESFSRPYAR
SMCIELERIHRSSRQPLFSPPPPPTEIDQRYGVEKRLVPSGPNPLHN

Other information
Ka divergence:0.180412KaKs divergence:0.999812
GC content 1 (%):50GC content 2 (%):51GC content divergence:0.01
Length 1 (bp):363Length 2 (bp):324Length divergence:-0.057
MFE 1 (kcal):-81.65MFE 2 (kcal):-76MFE divergence-0.036