Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G26620-AT1G69360
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Plant protein of unknown function (DUF863)
Function (paralog2):Plant protein of unknown function (DUF863)

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-0.11393773961623
Log2 mRNA fold difference:0.61970840147441
Log2 TE fold difference:-0.54930625005833
Sequences
Protein sequence

MRDAADSSSYSGYEKDFMKHTMLEHEAVFKNQVHELHRLYRVQKNLVEEVKGKNLNEVMN
VSDHHTSENESKRKLHGFLLPNSTCGEGSSTQASNGRLQNGGSSNGDASEGRDVKGRRRM
IDLQLPADEYLDTDETTNTGENTSFPPYNQLKSGRGDASHRSYPSGSCLDVKNSNGLADL
NEPLKGQDSEPAALSRDMYSHYGRNNAHVQGQWLEKNRTQNGWMVLEAGQDRSTQRDQVH
LPSHSGQVLSNNAFQPQSYPTTDHSKVKFSGERAHRELEVRSKTPQVSYDSYVESSVAST
APRSVNDYRPEFFKPLTHWSSSGRTMTSSNQKSYPVQTNPYMNFDTHARPDLSFENRSHV
SNGLYQGFSSGSKQSFYNFPSTGFKPNASIGEVANSHSFVNLQGPKRQECSAGLPWLKPQ
PPYRSGMSNGFFDLNASTNQFMDGTDAGDDLTCASVLKGLRSASYSNNANMGRVETNNSQ
SSTKIIGSPIFGKQFVCKQERTPLIPHSLWIANQHKEVNHLVKRDLDINLPCDASVSVDQ
HGAKAYYVDKKEGKKAANFRHYIDLNSCANEDDEDSGFLSSLSVKTKARTWIDLEAPPTL
ESEEEGDNSQDKTNEETWRMMQGQDGNSMNELIKVAAEAIVAISMAGHQRHPDDAASSST
DAASKSPLSWFAEIITSCGDELERKIDGSPEATDFEGNREDYSSGEIDYFEAMTLNIQET
KEEDYMPEPLVPENLKFEDTCINKPRRGQARRGRPKRDFQRDTLPGLSSLSRHEVTEDIQ
MFGGLMKTGDYTWSSGLAVRRNSKRKRNVTNINQAPLCPSMAQPMNESVSVGGLEDSKLS
GWGQATRRPRRQRCPPAGSNPPTVILT

MGETVHCGSFLSSMRDLSEDISNTCSYSMYCGGDKTLPYGQYQNGFSARPPTDSYERDFL
KQTMLEHEAVFKNQVYELHRLYRTQKSLMAEVKGKNFVDHLNNNEPTPGSGIKRGFLFGN
SICGEGSTSQDCNVGKDNKVLEVRPVKVRRTMIDLQLPADEYLHTEGDNTTCPPYEQSKE
VGENIFFESHRNDSSGSSLLMKNSNGFTDLNEPVQCQDSVPVSSSSRDLYSLYGANISHV
QGQWVEKNTSQNGWMVLEAGNGKSTPRDKLCLPSHSVQVLSNSAFQPLGYPSTDHSKLSG
ERASFKCEVRQRNPEVSYDSYVESSVASNVPSLNHGYRPESVRPWSHWISSWENRSSSSV
QKPLPLQANPFLTFNTQVRADSSAEMRSRDSNGLNQGFSSFSEESAFNFPSVNFNHLNNG
PKGAVTNGSLCESVMHQSLKNLQGPKKQECSSGLPWIKPKPLNKNGKTNGGLDLNASANH
QFMDERDMGDSSNYVHPQNGLRSVTCSNDANLRHVEMANSQSRRKILGFPISQKLSICEE
HPSLITSSVCISNEPKKVNNLVKINLDINLPCEASVSEGVVVDKEEGNKAATHRQHIDLN
FCASEDEDSGFCSNPRVETKATTLINVEAPLTLESEEEGGKFPEKRDEAGDSVDELIEAA
AEAIVTISLSYHCRNTDEAASSSTDAVDKEPLSWFVNTIASCGNDLESKIDACLEARDCE
GCREECSSGEFDYFEAMTLNLTQTKEEDYMPKPLIPEYLKFDGTGSMGITSNRPRRGQAR
RGRPKRDFQRDILPGLASLSRLEVTEDLQMFGGLMKATGYNWNSGMARRSSNRGRKRLVS
NIDRAPVCSSLAQPMNNSSVQMVGLEDRSLTGWGNATRRPRRHRCPAGTPPTVLLT

www.000webhost.com

Other information
Ka divergence:-0.272933KaKs divergence:0.651248
GC content 1 (%):44GC content 2 (%):43GC content divergence:-0.011
Length 1 (bp):2604Length 2 (bp):2691Length divergence:0.016
MFE 1 (kcal):-762.25MFE 2 (kcal):-822.1MFE divergence0.038