Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G26690-AT1G69460
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):emp24/gp25L/p24 family/GOLD family protein
Function (paralog2):emp24/gp25L/p24 family/GOLD family protein

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:2.5364304635317
Log2 mRNA fold difference:3.5093799041819
Log2 TE fold difference:-1.0129213672956
Sequences
Protein sequence

MFLRSLNLCTILLFLAISSQVSQSLHFELQSGRTKCISEDIKSNSMTVGKYTVVNPNEAH
PSPQSHKISIRVTSSYGNTYHHAEDVESGQFAFTAVESGDYMACYTAVDHKPEVTLSIDF
DWRTGVQSKSWSSVAKKSQVEVMEFDVKRLIETVNSIHEEMFYLREREEEMQNLNRATNS
KMAWLSFLSLFVCLGVAGMQFVHLKTFFEKKKVI

MFLQSQKLWTMLLILAIWSPISHSLHFDLHSGRTKCIAEDIKSNSMTVGKYNIDNPHEGQ
ALPQTHKISVKVTSNSGNNYHHAEQVDSGQFAFSAVEAGDYMACFTAVDHKPEVSLSIDF
EWKTGVQSKSWANVAKKSQVEVMEFEVKSLLDTVNSIHEEMYYLRDREEEMQDLNRSTNT
KMAWLSVLSFFVCIGVAGMQFLHLKTFFEKKKVI

www.000webhost.com

Other information
Ka divergence:0.0057449KaKs divergence:-0.383381
GC content 1 (%):42GC content 2 (%):41GC content divergence:-0.012
Length 1 (bp):645Length 2 (bp):645Length divergence:0
MFE 1 (kcal):-177.02MFE 2 (kcal):-164.21MFE divergence-0.038