Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G26770-AT1G69530
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):expansin A10
Function (paralog2):expansin A1

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:1.6045109481899
Log2 mRNA fold difference:1.4369212987029
Log2 TE fold difference:0.25633424236138
Sequences
Protein sequence

MCRLLTQDVNMGHLGFLVMIMVGVMASSVSGYGGGWINAHATFYGGGDASGTMGGACGYG
NLYSQGYGTSTAALSTALFNNGLSCGSCFEIRCENDGKWCLPGSIVVTATNFCPPNNALA
NNNGGWCNPPLEHFDLAQPVFQRIAQYRAGIVPVSYRRVPCRRRGGIRFTINGHSYFNLV
LITNVGGAGDVHSAAIKGSRTVWQAMSRNWGQNWQSNSYLNGQALSFKVTTSDGRTVVSF
NAAPAGWSYGQTFAGGQFR

MALVTFLFIATLGAMTSHVNGYAGGGWVNAHATFYGGGDASGTMGGACGYGNLYSQGYGT
NTAALSTALFNNGLSCGACFEIRCQNDGKWCLPGSIVVTATNFCPPNNALPNNAGGWCNP
PQQHFDLSQPVFQRIAQYRAGIVPVAYRRVPCVRRGGIRFTINGHSYFNLVLITNVGGAG
DVHSAMVKGSRTGWQAMSRNWGQNWQSNSYLNGQSLSFKVTTSDGQTIVSNNVANAGWSF
GQTFTVEAVRERGMIVIWSFLSIEVNLKRSGASSA

Other information
Ka divergence:0.096129KaKs divergence:-0.414661
GC content 1 (%):49GC content 2 (%):48GC content divergence:-0.01
Length 1 (bp):780Length 2 (bp):828Length divergence:0.03
MFE 1 (kcal):-254.48MFE 2 (kcal):-259.37MFE divergence0.01