Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G26830-AT1G69670
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):cullin 3
Function (paralog2):cullin 3B

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-2.0119046479772
Log2 mRNA fold difference:-2.1914618123049
Log2 TE fold difference:0.12115019052334
Sequences
Protein sequence

MSNQKKRNFQIEAFKHRVVVDPKYADKTWQILERAIHQIYNQDASGLSFEELYRNAYNMV
LHKFGEKLYTGFIATMTSHLKEKSKLIEAAQGGSFLEELNKKWNEHNKALEMIRDILMYM
DRTYIESTKKTHVHPMGLNLWRDNVVHFTKIHTRLLNTLLDLVQKERIGEVIDRGLMRNV
IKMFMDLGESVYQEDFEKPFLDASSEFYKVESQEFIESCDCGDYLKKSEKRLTEEIERVA
HYLDAKSEEKITSVVEKEMIANHMQRLVHMENSGLVNMLLNDKYEDLGRMYNLFRRVTNG
LVTVRDVMTSHLREMGKQLVTDPEKSKDPVEFVQRLLDERDKYDKIINTAFGNDKTFQNA
LNSSFEYFINLNARSPEFISLFVDDKLRKGLKGITDVDVEVILDKVMMLFRYLQEKDVFE
KYYKQHLAKRLLSGKTVSDDAERSLIVKLKTECGYQFTSKLEGMFTDMKTSEDTMRGFYG
SHPELSEGPTLIVQVLTTGSWPTQPAVPCNLPAEVSVLCEKFRSYYLGTHTGRRLSWQTN
MGTADIKAIFGKGQKHELNVSTFQMCVLMLFNNSDRLSYKEIEQATEIPAADLKRCLQSL
ACVKGKNVIKKEPMSKDIGEEDLFVVNDKFTSKFYKVKIGTVVAQKETEPEKQETRQRVE
EDRKPQIEAAIVRIMKSRKILDHNNIIAEVTKQLQPRFLANPTEIKKRIESLIERDFLER
DSTDRKLYRYLA

MSNQKKRNFQIEAFKQRVVVDPKYADKTWKILEHAIHEIYNHNASGLSFEELYRNAYNMV
LHKYGDKLYTGLVTTMTFHLKEICKSIEEAQGGAFLELLNRKWNDHNKALQMIRDILMYM
DRTYVSTTKKTHVHELGLHLWRDNVVYSSKIQTRLLNTLLDLVHKERTGEVIDRVLMRNV
IKMFMDLGESVYQDDFEKPFLEASAEFYKVESMEFIESCDCGEYLKKAEKPLVEEVERVV
NYLDAKSEAKITSVVEREMIANHVQRLVHMENSGLVNMLLNDKYEDMGRMYSLFRRVANG
LVTVRDVMTLHLREMGKQLVTDPEKSKDPVEFVQRLLDERDKYDRIINMAFNNDKTFQNA
LNSSFEYFVNLNTRSPEFISLFVDDKLRKGLKGVGEEDVDLILDKVMMLFRYLQEKDVFE
KYYKQHLAKRLLSGKTVSDDAERNLIVKLKTECGYQFTSKLEGMFTDMKTSHDTLLGFYN
SHPELSEGPTLVVQVLTTGSWPTQPTIQCNLPAEVSVLCEKFRSYYLGTHTGRRLSWQTN
MGTADIKAVFGKGQKHELNVSTFQMCVLMLFNNSDRLSYKEIEQATEIPTPDLKRCLQSM
ACVKGKNVLRKEPMSKEIAEEDWFVVNDRFASKFYKVKIGTVVAQKETEPEKQETRQRVE
EDRKPQIEAAIVRIMKSRRVLDHNNIIAEVTKQLQTRFLANPTEIKKRIESLIERDFLER
DNTDRKLYRYLA

Other information
Ka divergence:-0.0444658KaKs divergence:-0.27654
GC content 1 (%):42GC content 2 (%):40GC content divergence:-0.024
Length 1 (bp):2199Length 2 (bp):2199Length divergence:0
MFE 1 (kcal):-625.32MFE 2 (kcal):-601.66MFE divergence-0.019