Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G26920-AT1G69760
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-0.18897105613377
Log2 mRNA fold difference:-1.5497139827992
Log2 TE fold difference:1.2799868804067
Sequences
Protein sequence

MAETSDVSPLKRYREQETLVEEETNKRQKPTSSSSSASYNQILCLLNDSDEQNQHNNDLT
SFINALQQEISSDDQYAVVSETSNVEDSFSSCVSSKEEEVEDDSKEKVMQHLLEASDDEL
GIPNTDFGESNYEKANDGYVYGDSLLDGFGDAFWELEDEAANYYTLLQSELFM

MAETTTVTSSLKRQRDEQEQEIIKTQEETKRQKPSSSSSSYNQVLTLLKDEAENDITSLI
TTLQQEISNEEQNAAVFEENPSLSSSCSSSSSSCTSKEDEYDGDKEKVMKHLLEATDDEL
GIPNTEFGGSNYEMIKSETSQDYVNGFSLLDGFSVGLWELEDEAANYYTLLQSELFM

www.000webhost.com

Other information
Ka divergence:-0.016334KaKs divergence:-0.187976
GC content 1 (%):42GC content 2 (%):39GC content divergence:-0.037
Length 1 (bp):522Length 2 (bp):534Length divergence:0.011
MFE 1 (kcal):-125.98MFE 2 (kcal):-129.85MFE divergence0.015