Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G26960-AT1G69780
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):homeobox protein 23
Function (paralog2):Homeobox-leucine zipper protein family

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:1.7722855350171
Log2 mRNA fold difference:-0.43963012424255
Log2 TE fold difference:2.1481332382548
Sequences
Protein sequence

MSCNNNGLAFFPENFSLQNHHQEEEDHPQLLQDFHGFLGKRSPMNNVQGFCNLDMNGDEE
YSDDGSKMGEKKRRLNMEQLKALEKDFELGNKLESDRKLELARALGLQPRQIAIWFQNRR
ARSKTKQLEKDYDMLKRQFESLRDENEVLQTQNQKLQAQVMALKSREPIESINLNKETEG
SCSDRSENISGDIRPPEIDSQFALGHPPTTTTMQFFQNSSSEQRMVKEENSISNMFCGID
DQSGFWPWLDQQQYN

MSCNNGMSFFPSNFMIQTSYEDDHPHQSPSLAPLLPSCSLPQDLHGFASFLGKRSPMEGC
CDLETGNNMNGEEDYSDDGSQMGEKKRRLNMEQVKTLEKNFELGNKLEPERKMQLARALG
LQPRQIAIWFQNRRARWKTKQLEKDYDTLKRQFDTLKAENDLLQTHNQKLQAEIMGLKNR
EQTESINLNKETEGSCSNRSDNSSDNLRLDISTAPPSNDSTLTGGHPPPPQTVGRHFFPP
SPATATTTTTTMQFFQNSSSGQSMVKEENSISNMFCAMDDHSGFWPWLDQQQYN

Other information
Ka divergence:-0.176621KaKs divergence:0.986972
GC content 1 (%):40GC content 2 (%):40GC content divergence:0
Length 1 (bp):768Length 2 (bp):885Length divergence:0.071
MFE 1 (kcal):-198.36MFE 2 (kcal):-226.73MFE divergence0.067