Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G26970-AT1G69790
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Protein kinase superfamily protein
Function (paralog2):Protein kinase superfamily protein

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:0.55541080450866
Log2 mRNA fold difference:1.233911187102
Log2 TE fold difference:-0.54867213470849
Sequences
Protein sequence

MGNCFGFSAKVGNRESPYRGSSRISAKRSQSSRLSSLTIQSSSYNDDTSVASLQTPRSEG
ELLASPTLKAFTFNELKTATRNFRPDSVIGEGGFGYVYKGWIDERTLSPSKPGSGMVVAV
KKLKEEGFQGHRQWLAEVDCLGRLHHMNLVKLIGYCSKGDHIRLLVYEYMPKGSLENHLF
RRGAEPIPWRTRIKVAIGAARGLAFLHEAQVIYRDFKASNILLDSEFNAKLSDFGLAKVG
PTGDRTHVSTQVMGTQGYAAPEYVATGRITAKSDVYSFGVVLLELLSGRLTVDKTKVGVE
RNLVDWAIPYLGDKRKVFRIMDTKLGGQYPHKGACLTANTALQCLNQEPKLRPKMSDVLS
TLEELEMTLKSGSISNSVMKLTSSSSSFTAKQRVRTPVADPVLSSRRCRRVR

MGNCLDSSARVGNRESTFGGSSRISRKPNQSSRLSSLTIPSYSNNSFTTSSWSNLTPRSE
GELLPSPTLKAFTFNELKTATRNFKPNSMIGEGGFGCVYKGWIGERSLSPSKPGSGMVVA
VKKLKSEGFQGHKEWLTEVHYLGRLHHMNLVKLIGYCLEGEKRLLVYEYMPKGSLENHLF
RRGAEPIPWKTRMKVAFSAARGLSFLHEAKVIYRDFKASNILLDVDFNAKLSDFGLAKAG
PTGDRTHVTTQVIGTQGYAAPEYIATGRLTSKSDVYSFGVVLLELLSGRPTLDKSKVGVE
RNLVDWAIPYLVDRRKVFRIMDTKLGGQYPHKGACAAANIALRCLNTEPKLRPDMADVLS
TLQQLETSSKKMGSTQNIVMSPSSHMS

Other information
Ka divergence:0.12383KaKs divergence:0.0506799
GC content 1 (%):45GC content 2 (%):44GC content divergence:-0.011
Length 1 (bp):1239Length 2 (bp):1164Length divergence:-0.031
MFE 1 (kcal):-373.02MFE 2 (kcal):-366.02MFE divergence-0.009