Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G27110-AT1G27150
Species:Arabidopsis
Duplication type:TD
Function (paralog1):Tetratricopeptide repeat (TPR)-like superfamily protein
Function (paralog2):Tetratricopeptide repeat (TPR)-like superfamily protein

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:1.2688043623969
Log2 mRNA fold difference:1.7913174025044
Log2 TE fold difference:-0.55001819674822
Sequences
Protein sequence

MEASCTMSLKCMKEESRFVSCGYEVNTSSDDCIASINSYSDQVLGYGREKKVILEAPNYD
NDCVLANILAAHYLSSFDPVRARSYALAAESRLGKATLYEKAVFEAVSYLLSENMDDDVA
LELHSKLLKKFPKDLLSWKRVETLCSYMGRHDLSLPLFRKILPQNEGQVYVNGMLAFCLI
ELGHLREAEEAARKGCEINENDSWAHHALCHVLQTECRFKEAVKFMEEHSDSWDSCSSLR
FSHNWWHVAVCYLEGGSHISKVEEVYDHQMWKELEKDDAVARDVYTDALGLLLRLDTRGK
LDDGFQDRLEKLADSLTDKAMWYQDWLFDITTIWALSKVEKTSLAHELLEGLKSRTSAMN
PKKQKLMQKAILLAEAVYEYGKGNYEIALELLGLDFDAANYKVIGGSGLQMDVFNEIWYK
LLLLNGKSSTAIEVLEKVTKQRDGAPFLWRLLEESYSMEGKEKAGISAGKKAKALESSYF
KSA

MEKTVRCVRWGYEVNTSSDACIDAINSYFQQVLSYGRKRKVILEAPLYDKDCVLGSILAA
HFLSSSDPSRANSYVEAAASNLEQSTPYEKAVYEAVTYLISEDRDDDLAFEMHTKLLKRF
PKDLASLKRAQLLSFYMGQPDPFLGLVQQVLPANQEESYIHGLLAFPLLELGRMEEAAAA
SRKGYEINKEDAWAHHCLCHVLQHECRFKEAVEFMEALAGTWPSCSSFMYTHNWWHVALC
YLEGGSPMSKVEEIYDHHIWKELEKDDAVPPEVYLNALGLLIRLDVRDALDGFEDRLKNL
AVRLTNQANWYLEWHLDILIVWALAKVGETSRAHELLEGLKFRLSKKNKKKQQVMQKGIQ
LGEAVYEYARGNYEKALELLGSEFNAIGYKIVGASDEQIDVFNEMWCQLLLKTGQSSTAK
EVIRERIKARDGIPFMWRLLEKSYSMEGNAEAESSARERAKKLESCYF

www.000webhost.com

Other information
Ka divergence:-0.325885KaKs divergence:-0.422335
GC content 1 (%):42GC content 2 (%):42GC content divergence:0
Length 1 (bp):1452Length 2 (bp):1407Length divergence:-0.016
MFE 1 (kcal):-430.41MFE 2 (kcal):-443.16MFE divergence0.015