Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G27170-AT1G27180
Species:Arabidopsis
Duplication type:TD
Function (paralog1):transmembrane receptors;ATP binding
Function (paralog2):disease resistance protein (TIR-NBS-LRR class), putative

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-1.0289506474424
Log2 mRNA fold difference:-0.28257284194855
Log2 TE fold difference:-0.5561143398362
Sequences
Protein sequence

MESGVVSKPHRLKYDVFLSFRGADTRDNFGDHLYKALKDKVRVFRDNEGMERGDEISSSL
KAGMEDSAASVIVISRNYSGSRWCLDELAMLCKMKSSLDRRILPIFYHVDPSHVRKQSDH
IKKDFEEHQVRFSEEKEKVQEWREALTLVGNLAGYVCDKDSKDDDMIELVVKRVLAELSN
TPEKVGEFIVGLESPLKDLTGLIDTESSSGVQVLGLYGMGGIGKTTLAKAFYNKIVGNFE
QRAFISDIRERSSAENGLVTLQKTLIKELFRLVPEIEDVSIGLEKIKANVHEKKIIVVLD
DVDHIDQVHALVGETRWYGQGTLIVITTRDSEILSKLSVNQQYEVKCLTEPQALKLFSYH
SLRKEEPTKNLLALSKKIVQISGLLPLAVEVFGSLLYDKKEEKDWQTQLDKLKKTQPGNL
QDVLELSFKSLDDEEKKVFLDIACLFLKMEIKKDEVVIVLKGCGLNAEAALSVLRQKSLV
KILANDTLWMHDQIRDMGRQMVLKESREDPGLRSRLWDRGEIMTVLNNMKGTSSIRGIVL
DFKKKFARDPTADEIVSRNLRNNPGIYSVFNYLKNKLVRFPAEEKPKSSEITIPVESFAP
MTKLRLLQINNVELEGNLKLLPSELKWIQWKGCPLENLPPDFLARQLSVLDLSESGIRQV
QTLRNKMVDENLKVVILRGCHSLEAIPDLSNHEALEKLVFEQCTLLVKVPKSVGNLRKLI
HLDFRRCSKLSEFLVDVSGLKLLEKLFLSGCSDLSVLPENIGAMTSLKELLLDGTAIKNL
PESINRLQNLEILSLRGCKIQELPLCIGTLKSLEKLYLDDTALKNLPSSIGDLKNLQDLH
LVRCTSLSKIPDSINELKSLKKLFINGSAVEELPLKPSSLPSLYDFSAGDCKFLKQVPSS
IGRLNSLLQLQLSSTPIEALPEEIGALHFIRELELRNCKFLKFLPKSIGDMDTLYSLNLE
GSNIEELPEEFGKLEKLVELRMSNCKMLKRLPESFGDLKSLHRLYMKETLVSELPESFGN
LSNLMVLEMLKKPLFRISESNVPGTSEEPRFVEVPNSFSKLLKLEELDACSWRISGKIPD
DLEKLSCLMKLNLGNNYFHSLPSSLVKLSNLQELSLRDCRELKRLPPLPCKLEQLNLANC
FSLESVSDLSELTILTDLNLTNCAKVVDIPGLEHLTALKRLYMTGCNSNYSLAVKKRLSK
ASLKMMRNLSLPGNRVPDWFSQGPVTFSAQPNRELRGVIIAVVVALNDETEDDDYQLPDV
MEVQAQIHKLDHHKCTNTLHLSGVPRTNNDQLHICRYSAFHPLVTMLKDGYTIQVIKRNP
PIKQGVELKMHGIHLVYEGDDDLEGRENTLPETQQTVSQKLANFFSSFEEEEGETISESE
STVI

MMKTGAVVSNPRSRVKWDAFLSFQRDTSHNFTDRLYEALVKEELRVWNDDLERVDHDHDH
ELRPSLVEAIEDSVAFVVVLSPNYANSHLRLEELAKLCDLKCLMVPIFYKVEPREVKEQN
GPFEKDFEEHSKRFGEEKIQRWKGAMTTVGNISGFICGYEIQLEMETGVVPNRLKYSVFL
SFRGFDTRTNFCERLYIALNEKQNVRVFRDNEGMEKGDKIDPSLFEAIEDSAASVIILST
NYANSSWCLDELALLCDLRSSLKRPMIPIFYGVNPEDVRKQSGEFRKDFEEKAKSFDEET
IQRWKRAMNLVGNIPGYVCTAKTVGDDNEGINREKVDDMIDLVVKKVVAAVRNRPEIVAD
YTVGLESPIKDLMKLFNTESSSGIQVMGLYGMGGIGKTTLAKAFYNKIIVNFNRHRVFIE
SVRGKSSDQDGLVNLQKTLIKELFRLVPEIEDVSIGLEKIKENVHEKKIIVVLDDVDHID
QVNALVGETSWYGEGSLIVITTRDSEILSKLSVNQQYEVKCLTEPQALKLFSFYSLRKEK
PPTQGLLELSKKIAEVTGLLPLAVKVFGSHFYDKDENEWQVELEKLKTQQDKLHGVLALS
FKSLDEEEKKIFLDIACLFLKMDITKEEVVDILKGCGLNAEAALRVLIQKSLLTILTDDT
LWMHDQIRDMGRQMVHKESSDDPEMRSRLWDRGEIMNVLDYMKGTSSIRGIVLDFNKKFA
RDHTADEIFSSNLRNNPGIYSVFNYLKNKLVRFPAEEKPKRSEITIPVESFAPMKKLRLL
QINNVELEGDLKLLPSELKWIQWKGFPLENLPPDILSRQLGVLDLSESGVRRVKTLPRKR
GDENLKVVNLRGCHGLEAIPDLSNHNALEKLVLERCNLLVKVPRSVGNLGKLLQLDLRRC
SSLSEFLGDVSGLKCLEKFFLSGCSNLSVLPENIGSMPCLKELLLDGTAISNLPYSIFRL
QKLEKLSLMGCRSIEELPSCVGYLTSLEDLYLDDTALRNLPSSIGDLKNLQKLHLMRCTS
LSTIPETINKLMSLKELFINGSAVEELPIETGSLLCLTDLSAGDCKFLKQVPSSIGGLNS
LLQLQLDSTPIEALPEEIGDLHFIRQLDLRNCKSLKALPKTIGKMDTLYSLNLVGSNIEE
LPEEFGKLENLVELRMNNCKMLKRLPKSFGDLKSLHRLYMQETLVAELPESFGNLSNLMV
LEMLKKPLFRISESNVPGTSEEPRFVEVPNSFSKLLKLEELDACSWRISGKIPDDLEKLS
CLMKLNLGNNYFHSLPSSLVKLSNLQELSLRDCRELKRLPPLPCKLEQLNLANCFSLESV
SDLSELTILTDLNLTNCAKVVDIPGLEHLTALKRLYMTGCNSNYSLAVKKRLSKASLKMM
RNLSLPGNRVPDWFSQGPVTFSAQPNRELRGVIIAVVVALNDETEDDDYQLPDVMEVQAQ
IHKLDHHKCTNTLHLSGVPRTNNDQLHICRYSAFHPLVTMLKDGYTIQVIKRNPPIKQGV
ELKMHGIHLVYEGDDDLEGRENTLPEAQQTVSQKLANFFSSFEEGEASAKGDSTVA

Other information
Ka divergence:-0.0397387KaKs divergence:-0.363001
GC content 1 (%):42GC content 2 (%):43GC content divergence:0.012
Length 1 (bp):4155Length 2 (bp):4671Length divergence:0.058
MFE 1 (kcal):-1215.45MFE 2 (kcal):-1404.44MFE divergence0.072