Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G27190-AT1G69990
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Leucine-rich repeat protein kinase family protein
Function (paralog2):Leucine-rich repeat protein kinase family protein

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-3.8102595906764
Log2 mRNA fold difference:-5.6962702090148
Log2 TE fold difference:1.9389823952099
Sequences
Protein sequence

MKKIFITLLWLLFISSFLCSSSSAEDDVLCLQGLKNSLIDPSSRLSSWSFPNSSASSICK
LTGVSCWNEKENRIISLQLQSMQLAGEIPESLKLCRSLQSLDLSGNDLSGSIPSQICSWL
PYLVTLDLSGNKLGGSIPTQIVECKFLNALILSDNKLSGSIPSQLSRLDRLRRLSLAGND
LSGTIPSELARFGGDDFSGNNGLCGKPLSRCGALNGRNLSIIIVAGVLGAVGSLCVGLVI
FWWFFIREGSRKKKGYGAGKSKDDSDWIGLLRSHKLVQVTLFQKPIVKIKLGDLMAATNN
FSSGNIDVSSRTGVSYKADLPDGSALAVKRLSACGFGEKQFRSEMNKLGELRHPNLVPLL
GYCVVEDERLLVYKHMVNGTLFSQLHNGGLCDAVLDWPTRRAIGVGAAKGLAWLHHGCQP
PYLHQFISSNVILLDDDFDARITDYGLAKLVGSRDSNDSSFNNGDLGELGYVAPEYSSTM
VASLKGDVYGFGIVLLELVTGQKPLSVINGVEGFKGSLVDWVSQYLGTGRSKDAIDRSIC
DKGHDEEILQFLKIACSCVVSRPKERPTMIQVYESLKNMADKHGVSEHYDEFPLVFNKQE
A

MKTISIFFVIILMSSSHAEDDVLCLKGFKSSLKDPSNQLNTWSFPNSSSSICKLTGVSCW
NAKENRILSLQLQSMQLSGQIPESLKLCRSLQSLDLSFNDFSGLIPSQICSWLPYLVTLD
LSGNKLSGSIPSQIVDCKFLNSLALNQNKLTGSIPSELTRLNRLQRLSLADNDLSGSIPS
ELSHYGEDGFRGNGGLCGKPLSNCGSFNGKNLTIIVTAGVIGAVGSLCVGFGMFWWFFIR
DRRKMNNYGYGAGKCKDDSDWIGLLRSHKLVQVTLFQKPIVKIKLVDLIEATNGFDSGNI
VVSSRSGVSYKADLPDGSTLEVKRLSSCCELSEKQFRSEINKLGQIRHPNLVPLLGFCVV
EDEILLVYKHMANGTLYSQLQQWDIDWPTRVRVAVGAARGLAWLHHGCQPLYMHQYISSN
VILLDEDFDARVIDYGLGKLVSSQDSKDSSFSNGKFGYVAPEYSSTMVASLSGDVYGFGI
VLLEIVTGQKPVLINNGEEGFKESLVEWVSKHLSNGRSKDAIDRRIFGKGYDDEIMQVLR
IACSCVVSRPKERPLMIQVYESLKNLGDQHGFFSEYSDEFPLIFNKQEHLK

www.000webhost.com

Other information
Ka divergence:0.318071KaKs divergence:-0.268582
GC content 1 (%):43GC content 2 (%):41GC content divergence:-0.024
Length 1 (bp):1806Length 2 (bp):1776Length divergence:-0.008
MFE 1 (kcal):-554.7MFE 2 (kcal):-522.94MFE divergence-0.029