Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G27330-AT1G27350
Species:Arabidopsis
Duplication type:TD
Function (paralog1):Ribosome associated membrane protein RAMP4
Function (paralog2):Ribosome associated membrane protein RAMP4

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:0.064073691705834
Log2 mRNA fold difference:-0.87325115356151
Log2 TE fold difference:0.93225271051978
Sequences
Protein sequence

MTTSKRLADRKIEKFDKNILKRGFVPETTTKKGKDYPVGPILLGFFVFVVIGSSLFQIIR
TATSGGMA

MTTSKRLADRKIEKFDKNILKRGFVPETTTKKGKDYPVGPILLGFFVFVVIGSSLFQIIR
TATSGGMA

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):43GC content 2 (%):42GC content divergence:-0.012
Length 1 (bp):207Length 2 (bp):207Length divergence:0
MFE 1 (kcal):-51.3MFE 2 (kcal):-53.7MFE divergence0.023