Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G27940-AT1G28010
Species:Arabidopsis
Duplication type:TD
Function (paralog1):P-glycoprotein 13
Function (paralog2):P-glycoprotein 14

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:1.2941317258701
Log2 mRNA fold difference:0.97293294280088
Log2 TE fold difference:0.3100019496934
Sequences
Protein sequence

MDNTERSSNGNIQAETEAKEEKKNIKKESVSLMGLFSAADKLDYFLMLLGGLGACIHGAT
LPLFFVFFGKMLDSLGNLSTDPKAISSRVSQNALYLVYLGLVNFVSAWIGVSCWMQTGER
QTARLRINYLKSILAKDITFFDTEARDSNLIFHISSDAILVQDAIGDKTDHVLRYLSQFI
AGFVIGFLSVWQLTLLTLGVVPLIAIAGGGYAIVMSTISEKSETAYADAGKVAEEVMSQV
RTVYAFVGEEKAVKSYSNSLKKALKLGKRSGLAKGLGVGLTYSLLFCAWALLLWYASLLV
RHGKTNGAKAFTTILNVIFSGFALGQAAPSLSAIAKGRVAAANIFRMIGNNNSESSQRLD
EGTTLQNVAGRIEFQKVSFAYPSRPNMVFENLSFTIRSGKTFAFVGPSGSGKSTIISMVQ
RFYEPNSGEILLDGNDIKSLKLKWFREQLGLVSQEPALFATTIASNILLGKENANMDQII
EAAKAANADSFIKSLPNGYNTQVGEGGTQLSGGQKQRIAIARAVLRNPKILLLDEATSAL
DAESEKIVQQALDNVMEKRTTIVVAHRLSTIRNVDKIVVLRDGQVRETGSHSELMLRGGD
YATLVNCQETEPQENSRSIMSETCKSQAGSSSSRRVSSSRRTSSFRVDQEKTKNDDSKKD
FSSSSMIWELIKLNSPEWPYALLGSIGAVLAGAQTPLFSMGIAYVLTAFYSPFPNVIKRD
VEKVAIIFAGAGIVTAPIYLLQHYFYTLMGERLTSRVRLSLFSAILSNEIGWFDLDENNT
GSLTSILAADATLVRSALADRLSTIVQNLSLTVTALALAFFYSWRVAAVVTACFPLLIAA
SLTEQLFLKGFGGDYTRAYSRATSVAREAIANIRTVAAYGAEKQISEQFTCELSKPTKNA
FVRGHISGFGYGLSQFLAFCSYALGLWYVSVLINHKETNFGDSIKSFMVLIVTAFSVSET
LALTPDIVKGTQALGSVFRVLHRETKISPDQPNSRMVSQVKGDIEFRNVSFVYPTRPEID
IFKNLNLRVSAGKSLAVVGPSGSGKSTVIGLIMRFYDPSNGNLCIDGQDIKTLNLRSLRK
KLALVQQEPALFSTTIYENIKYGNENASEAEIMEAAKAANAHEFIIKMEEGYKTHAGDKG
VQLSGGQKQRVAIARAVLKDPSVLLLDEATSALDTSSEKLVQEALDKLMKGRTTVLVAHR
LSTIRKADTVAVLHKGRVVEKGSHRELVSIPNGFYKQLTSLQEVL

MDNIEPPFSGNIHAETEVKKEEKKKMKKESVSLMGLFSAADNVDYFLMFLGGLGTCIHGG
TLPLFFVFFGGMLDSLGKLSTDPNAISSRVSQNALYLVYLGLVNLVSAWIGVACWMQTGE
RQTARLRINYLKSILAKDITFFDTEARDSNFIFHISSDAILVQDAIGDKTGHVLRYLCQF
IAGFVIGFLSVWQLTLLTLGVVPLIAIAGGGYAIVMSTISEKSEAAYADAGKVAEEVMSQ
VRTVYAFVGEEKAVKSYSNSLKKALKLSKRSGLAKGLGVGLTYSLLFCAWALLFWYASLL
VRHGKTNGAKAFTTILNVIYSGFALGQAVPSLSAISKGRVAAANIFKMIGNNNLESSERL
ENGTTLQNVVGKIEFCGVSFAYPSRPNMVFENLSFTIHSGKTFAFVGPSGSGKSTIISMV
QRFYEPRSGEILLDGNDIKNLKLKWLREQMGLVSQEPALFATTIASNILLGKEKANMDQI
IEAAKAANADSFIKSLPNGYNTQVGEGGTQLSGGQKQRIAIARAVLRNPKILLLDEATSA
LDAESEKIVQQALDNVMEKRTTIVIAHRLSTIRNVDKIVVLRDGQVRETGSHSELISRGG
DYATLVNCQDTEPQENLRSVMYESCRSQAGSYSSRRVFSSRRTSSFREDQEKTEKDSKGE
DLISSSSMIWELIKLNAPEWLYALLGSIGAVLAGSQPALFSMGLAYVLTTFYSPFPSLIK
REVDKVAIIFVGAGIVTAPIYILQHYFYTLMGERLTSRVRLSLFSAILSNEIGWFDLDEN
NTGSLTSILAADATLVRSAIADRLSTIVQNLSLTITALALAFFYSWRVAAVVTACFPLLI
AASLTEQLFLKGFGGDYTRAYSRATSLAREAISNIRTVAAFSAEKQISEQFTCELSKPTK
SALLRGHISGFGYGLSQCLAFCSYALGLWYISVLIKRNETNFEDSIKSFMVLLVTAYSVA
ETLALTPDIVKGTQALGSVFRVLHRETEIPPDQPNSRLVTHIKGDIEFRNVSFAYPTRPE
IAIFKNLNLRVSAGKSLAVVGPSGSGKSTVIGLIMRFYDPSNGNLCIDGHDIKSVNLRSL
RKKLALVQQEPALFSTSIHENIKYGNENASEAEIIEAAKAANAHEFISRMEEGYMTHVGD
KGVQLSGGQKQRVAIARAVLKDPSVLLLDEATSALDTSAEKQVQEALDKLMKGRTTILVA
HRLSTIRKADTIVVLHKGKVVEKGSHRELVSKSDGFYKKLTSLQEAV

www.000webhost.com

Other information
Ka divergence:0.0541833KaKs divergence:0.988019
GC content 1 (%):42GC content 2 (%):43GC content divergence:0.012
Length 1 (bp):3738Length 2 (bp):3744Length divergence:0.001
MFE 1 (kcal):-1133.83MFE 2 (kcal):-1109.56MFE divergence-0.011