Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G28050-AT2G33500
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):B-box type zinc finger protein with CCT domain
Function (paralog2):B-box type zinc finger protein with CCT domain

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:0.025730974994005
Log2 mRNA fold difference:0.67039875613589
Log2 TE fold difference:-0.418262919929
Sequences
Protein sequence

MSSSERVPCDFCGERTAVLFCRADTAKLCLPCDQQVHTANLLSRKHVRSQICDNCGNEPV
SVRCFTDNLILCQECDWDVHGSCSVSDAHVRSAVEGFSGCPSALELAALWGLDLEQGRKD
EENQVPMMAMMMDNFGMQLDSWVLGSNELIVPSDTTFKKRGSCGSSCGRYKQVLCKQLEE
LLKSGVVGGDGDDGDRDRDCDREGACDGDGDGEAGEGLMVPEMSERLKWSRDVEEINGGG
GGGVNQQWNATTTNPSGGQSSQIWDFNLGQSRGPEDTSRVEAAYVGKGAASSFTINNFVD
HMNETCSTNVKGVKEIKKDDYKRSTSGQVQPTKSESNNRPITFGSEKGSNSSSDLHFTEH
IAGTSCKTTRLVATKADLERLAQNRGDAMQRYKEKRKTRRYDKTIRYESRKARADTRLRV
RGRFVKASEAPYP

MGTSTTESVVACEFCGERTAVLFCRADTAKLCLPCDQHVHSANLLSRKHVRSQICDNCSK
EPVSVRCFTDNLVLCQECDWDVHGSCSSSATHERSAVEGFSGCPSVLELAAVWGIDLKGK
KKEDDEDELTKNFGMGLDSWGSGSNIVQELIVPYDVSCKKQSFSFGRSKQVVFEQLELLK
RGFVEGEGEIMVPEGINGGGSISQPSPTTSFTSLLMSQSLCGNGMQWNATNHSTGQNTQI
WDFNLGQSRNPDEPSPVETKGSTFTFNNVTHLKNDTRTTNMNAFKESYQQEDSVHSTSTK
GQETSKSNNIPAAIHSHKSSNDSCGLHCTEHIAITSNRATRLVAVTNADLEQMAQNRDNA
MQRYKEKKKTRRYDKTIRYETRKARAETRLRVKGRFVKATDP

Other information
Ka divergence:0.0796725KaKs divergence:0.0171245
GC content 1 (%):47GC content 2 (%):46GC content divergence:-0.011
Length 1 (bp):1302Length 2 (bp):1209Length divergence:-0.037
MFE 1 (kcal):-419.8MFE 2 (kcal):-365.4MFE divergence-0.069