Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G28070-AT2G33510
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:2.7210454765099
Log2 mRNA fold difference:1.7783046129344
Log2 TE fold difference:1.0071234076664
Sequences
Protein sequence

MADITEYLERSMQNCSLIDRRSSMGDGFGMSDEHIPISDRFLELSSHFSVPSHLEQCLDL
KTGEIYYRSWNSGMRVKEDPRKSMSRGNYADQSSGESSGTVFSSEEVSSYYESEESSSES
SPSSRKYHKEEQDEDVLVVAGCKACLMYFMVPKLFKDCPKCATQLLHFDQLHSTSP

MKAPNMETITESLEKSMMNCSLNDRRRRVVGDGFGRSSSNEHMTPISDRTLELNSHLSLP
CHWEQCLDLKVKLITTETSNSCRFRTGEIYYINWKNGMRVKEDPRKVMNADPDSGDSYGT
VCSEEDSSYYDSEESSSESSPSSRENHKEEEEEEEEEEEEEEDVLVVAGCKACFMYFMVP
KLVEDCPKCAAQLLHFDRPHSASS

www.000webhost.com

Other information
Ka divergence:-0.42112KaKs divergence:-0.592429
GC content 1 (%):40GC content 2 (%):42GC content divergence:0.024
Length 1 (bp):531Length 2 (bp):615Length divergence:0.073
MFE 1 (kcal):-147.5MFE 2 (kcal):-176.81MFE divergence0.09