Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G28110-AT2G33530
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):serine carboxypeptidase-like 45
Function (paralog2):serine carboxypeptidase-like 46

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:0.32252376127393
Log2 mRNA fold difference:0.72048301676757
Log2 TE fold difference:-0.40879747765545
Sequences
Protein sequence

MSPLQWLTISFALIIFHSLTVSSSVLSHSDRVTRLPGQPRVGFQQYSGYVTVDDKKQRAL
FYYFAEAETNPSSKPLVLWLNGGPGCSSLGVGAFSENGPFRPKGPILVKNQHSWNQEANM
LYLETPVGVGFSYSTQSSHYEGVNDKITARDNLVFLQRWFLKFPHYLNRSLFITGESYAG
HYVPQLAELMIQYNKKHHLFNLRGIAIGNPVLEFATDFNSRAEYFWSHGLISDSTYKMFT
SYCNYSRYVSEYYRGSMSSMCSKVMSQVSTETSRFVDKYDVTLDVCIPSVLSQSKVVSPN
QVGESVDVCVEDETVNYLNRRDVQEALHARLIGVREWTVCSNVLDYQLLDVEIPTINIVG
SLVKAGVPVLVYSGDQDSVIPLTGSRTLVSRLAKQLGLRTSVPYRVWFAGQQVGGWTQVY
GNVLSFATVRGASHEVPFSQPERSLVLFKAFLDGHPLPEEF

MPRLQCLTMATSLILLLQALSLVSSTILSRADRITRLPGQPRVGFQQYSGYVTIDEKKQR
ALFYYLAEAETKPISKPLVLWLNGGPGCSSLGVGAFSENGPFRPKGSILVRNQHSWNQEA
NMLYLETPVGVGFSYANESSSYEGVNDKITAKDNLVFLQKWFLKFPQYLNRSLFITGESY
AGHYVPQLAQLMIQYNKKHNLFNLKGIAIGNPVMEFATDFNSRAEYFWSHGLISDPTYKL
FTSSCNYSRFLSEYHRGSVSSMCTKVLSQVGIETSRFIDKYDVTLDVCIPSVLSQSKVVS
PQPQQVGETVDVCLEDETVNYLNRRDVQKALHARLVGTRKWTVCSDVLDYEVLDVEVPTI
NIVGSLVKAGVPVFVYSGDQDSVIPLTGSRTLVKRLAEELGLRTTVPYRVWFAGQQVGGW
TQVYGNTLAFATVRGAAHEVPFSQPARALVLFKAFLGGRPLPEEF

www.000webhost.com

Other information
Ka divergence:0.300247KaKs divergence:0.449512
GC content 1 (%):44GC content 2 (%):44GC content divergence:0
Length 1 (bp):1386Length 2 (bp):1398Length divergence:0.004
MFE 1 (kcal):-426.8MFE 2 (kcal):-444.6MFE divergence0.02