Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G28290-AT2G33790
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):arabinogalactan protein 31
Function (paralog2):arabinogalactan protein 30

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:-1.1218856196135
Log2 mRNA fold difference:-1.3302927841325
Log2 TE fold difference:0.21053570936636
Sequences
Protein sequence

MGFIGKSVLVSLVALWCFTSSVFTEEVNHKTQTPSLAPAPAPYHHGHHHPHPPHHHHPHP
HPHPHPPAKSPVKPPVKAPVSPPAKPPVKPPVYPPTKAPVKPPTKPPVKPPVSPPAKPPV
KPPVYPPTKAPVKPPTKPPVKPPVYPPTKAPVKPPTKPPVKPPVYPPTKAPVKPPTKPPV
KPPVSPPAKPPVKPPVYPPTKAPVKPPVSPPTKPPVTPPVYPPKFNRSLVAVRGTVYCKS
CKYAAFNTLLGAKPIEGATVKLVCKSKKNITAETTTDKNGYFLLLAPKTVTNFGFRGCRV
YLVKSKDYKCSKVSKLFGGDVGAELKPEKKLGKSTVVVNKLVYGLFNVGPFAFNPSCPK

MGIIGKSVSLTLFALLCFTSSVFTLGVNQPGSSDPFHSLPQHLPLPPIKLPTLPPAKAPI
KLPAYPPAKAPIKLPTLPPAKAPIKLPTLPPIKPPVLPPVYPPKYNKTLVAVRGVVYCKA
CKYAGVNNVQGAKPVKDAVVRLVCKNKKNSISETKTDKNGYFMLLAPKTVTNYDIKGCRA
FLVKSPDTKCSKVSSLHDGGKGSVLKPVLKPGFSSTIMRWFKYSVYNVGPFAFEPTCPK

www.000webhost.com

Other information
Ka divergence:0.330801KaKs divergence:0.228694
GC content 1 (%):53GC content 2 (%):49GC content divergence:-0.039
Length 1 (bp):1080Length 2 (bp):720Length divergence:-0.2
MFE 1 (kcal):-266.28MFE 2 (kcal):-181.63MFE divergence-0.189