Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G28330-AT2G33830
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):dormancy-associated protein-like 1
Function (paralog2):Dormancy/auxin associated family protein

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:0.66168071286841
Log2 mRNA fold difference:1.6495788001572
Log2 TE fold difference:-0.98778817472549
Sequences
Protein sequence

MVLLEKLWDDVVAGPQPDRGLGRLRKITTQPINIRDIGEGSSSKVVMHRSLTMPAAVSPG
TPTTPTTPTTPRKDNVWRSVFNPGSNLATRAIGSNIFDKPTHPNSPSVYDCVDNEAQRKE
HVALCLVGAWIKSRVVGSLIDRTWGVCRLYSGDSRSQHR

MWDETVAGPKPEHGLGRLRNKITTQPLDIKGVGEGSSSKTVAAVAGSPGTPTTPGSARKE
NVWRSVFHPGSNIATRGMGTNLFDKPSHPNSPTVYDWLYSDDTRSKHR

Other information
Ka divergence:0.523269KaKs divergence:0.241665
GC content 1 (%):53GC content 2 (%):55GC content divergence:0.019
Length 1 (bp):480Length 2 (bp):327Length divergence:-0.19
MFE 1 (kcal):-156.8MFE 2 (kcal):-105.6MFE divergence-0.195