Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G28350-AT2G33840
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Nucleotidylyl transferase superfamily protein
Function (paralog2):Tyrosyl-tRNA synthetase, class Ib, bacterial/mitochondrial

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:0.56029199324869
Log2 mRNA fold difference:0.5194689447123
Log2 TE fold difference:0.088086574921887
Sequences
Protein sequence

MEALSINAPTQASTLPSGLQISKEVEKRYNVVRSVGEQCIHDDELKDLLAKKAAPVCYDG
FEPSGRMHIAQGLMKIMNVNKLTSAGCRVKIWIADWFAYMNNKLGGDLKKIRVVGEYFKE
IFQAAGMNSENVEFLWSSDEINAKGDEYWPLVMDIACRNSLAQIKRCMPIMGLSENEELS
AAHILYVCMQCADTFFLEADICQLGMDQQTVNLLARDYCDVVKRENKPVILSHHMLPGLQ
QGQKKMSKSDPSSAIFMEDEEAEVNVKIKKAYCPPDIVEGNPCLEYVKHIILPWFSEFTV
ERDEKYGGNRTFKSFEDITTDYESGQLHPKDLKDALSKALNKILQPVRDHFKTNSRAKNL
LKQVKGYKVTRVIPTASSTKEEDLSINTSASSSAAGLQMSEEAEMKYKIVRSIGEECIQE
DELKNLLAKKPAPICYDGFEPSGRMHIAQGVMKVTNVNKLTSAGCQVKIWIADWFAQLNN
KLGGDLERIRVVGEYFKEIWQAGGMNNDKVEFLWASDEINGKGSKYWPLVMDIARRNNLR
RILRCGQIMGRSETEVLSAAQILYPCMQCADIFLLEADICQLGMDQRKVNMLAREYCADI
KRKNKPIILSHHMLPGLQQGQEKMSKSDPSSAIFMEDEEADVNEKISKAYCPPKTVEGNP
CLEYVKYIVLPRFNEFKVESEKNGGNKTFNSFEDIVADYETGELHPEDLKKALMKALNIT
LQPVRDHFKTNERAKNLLEQVKAFRVTR

MADQSSEIVNALSSEMEAVSVSSTQASSSSDGFQMSEEVEKRYKIVRSIGEECIQEEELK
NLLAKKAAPICYDGFEPSGRMHIAQGVMKVINVNKMTSAGCRVKIWIADWFAQLNNKMGG
DLKKIRVVGEYFQEIWKAAGMDNDKVEFLWSSEEINSKADKYWPLVMDIARKNKLPRILR
CVQIMGRSETDELSAAQILYPCMQCADIFFLEADICQLGMDQRKVNVLAREYCDDIKRKN
KPIILSHHMLPGLQQGQEKMSKSDPLSAIFMEDEEAEVNVKIKKAYCPPKVVKGNPCLEY
IKYIILPWFDEFTVERNEEYGGNKTYKSFEDIAADYESGELHPGDLKKGLMNALNKILQP
VRDHFKTDARAKNLLKQIKAYRVTR

www.000webhost.com

Other information
Ka divergence:-0.427876KaKs divergence:-0.240714
GC content 1 (%):43GC content 2 (%):42GC content divergence:-0.012
Length 1 (bp):2247Length 2 (bp):1158Length divergence:-0.32
MFE 1 (kcal):-693.14MFE 2 (kcal):-333.02MFE divergence-0.351