Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G28570-AT1G28580
Species:Arabidopsis
Duplication type:TD
Function (paralog1):SGNH hydrolase-type esterase superfamily protein
Function (paralog2):GDSL-like Lipase/Acylhydrolase superfamily protein

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:3.5347813848093
Log2 mRNA fold difference:3.2223378487939
Log2 TE fold difference:0.42428137974434
Sequences
Protein sequence

MATLFMKLVSFFLILSTFCLTTVNSEPQCHNFKSIISFGDSIADTGNLLALSDPTNLPKV
AFLPYGETFFHHPTGRFSNGRLIIDFIAEFLGFPLVPPFYGSQNANFEKGVNFAVGGATA
LERSFLEERGIHFPYTNVSLAVQLSSFKESLPNLCVSPSDCRDMIENSLILMGEIGGNDY
NYAFFVGKNIEEIKELVPLVIETISSAITELIGMGGKTFLVPGEFPLGCSVAYLSLYQTS
NIEEYDPLTGCLKWLNKFSEYHDEQLQAELNRLQKLYPHVNIIYADYYNTLLRLAQEPAK
FGFISRPLPACCALGGPFNFTLGRKRGTQVPECCDDPSKYVSWDGVHMTEAAYRLMAEGI
LKGPYAIPPFDWSCLSSEIKNTQNSLMNN

MAYPGSPILMKLLVFIFLSTFVVTNVSSETKCREFKSIISFGDSIADTGNLLGLSDPKDL
PHMAFPPYGENFFHHPTGRFSNGRLIIDFIAEFLGLPLVPPFYGSHNANFEKGVNFAVGG
ATALERSFLEDRGIHFPYTNVSLGVQLNSFKESLPSICGSPSDCRDMIENALILMGEIGG
NDYNYAFFVDKGIEEIKELMPLVITTISSAITELIGMGGRTFLVPGEFPVGCSVLYLTSH
QTSNMEEYDPLTGCLKWLNKFGENHGEQLRAELNRLQKLYPHVNIIYADYYNALFHLYQE
PAKFGFMNRPLSACCGAGGPYNYTVGRKCGTDIVESCDDPSKYVAWDGVHMTEAAYRLMA
EGILNGPYAIPPFDWSCRSSGVKNSGSSDT

www.000webhost.com

Other information
Ka divergence:0.0909629KaKs divergence:0.116511
GC content 1 (%):43GC content 2 (%):45GC content divergence:0.023
Length 1 (bp):1170Length 2 (bp):1173Length divergence:0.001
MFE 1 (kcal):-361.71MFE 2 (kcal):-351.8MFE divergence-0.014