Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G28960-AT2G33980
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):nudix hydrolase homolog 15
Function (paralog2):nudix hydrolase homolog 22

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-2.3542101017312
Log2 mRNA fold difference:-3.0457278822404
Log2 TE fold difference:0.9750465284238
Sequences
Protein sequence

MFLLYRRLPSFARTTTTTLLCKSMEPAITATSSSSFGGGSSRLAALAQQLRQYKPPPSSS
FDDSEEMQTDQETAGKVVSQVGFQESIAPLSKDPDRFKPKRAAVLICLFEGDDGDLRVIL
TKRSSKLSTHSGEVSLPGGKAEEDDKDDGMTATREAEEEIGLDPSLVDVVTSLEPFLSKH
LLRVIPVIGILRDKNKFNPIPNPGEVEAVFDAPLEMFLKDENRRSEEREWMGEKYLIHYF
DYRTGDKDYMIWGLTAGILIRAASVTYERPPAFIEQCPKFKYPKMVEKHTCMP

MKSGASAASPTAKSFNFGSSRLLALAQQLRVYKPPLSSSFDEREELLAYKESTRKSITHV
GFQESMAPVRFRPKKAAVLICLFEGDDGDLRVILTKRSSTLSTHSGEVSLPGGKAEEHDK
DDGITATREAEEEIGLDPSLVDVVAFLEPFLSQHLLRVIPVVGILWDRKAFNPTPNPAEV
EAVLDAPFEMFLKDENRRSEEFDWMGEKHLVHFFDYKTGDSDYVIWGLTARILIRAATVV
YQRPPAFIEQKPNLKYSKMNQATRLYGWLKPLANLHESCENGRLLGHVPAYCLRYLVGIS
SR

Other information
Ka divergence:0.377353KaKs divergence:0.24042
GC content 1 (%):43GC content 2 (%):44GC content divergence:0.011
Length 1 (bp):882Length 2 (bp):909Length divergence:0.015
MFE 1 (kcal):-260.97MFE 2 (kcal):-279.34MFE divergence0.034