Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G29030-AT2G34040
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Apoptosis inhibitory protein 5 (API5)
Function (paralog2):Apoptosis inhibitory protein 5 (API5)

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:2.5699683936788
Log2 mRNA fold difference:2.6208039654308
Log2 TE fold difference:-0.042373845166396
Sequences
Protein sequence

MSEQYSEDAKHIEKLYEFDERLSESTDKSQNVQDYEGIIELSKTNIKTKQLGAQLIPRYF
KFFTSLATEAFDAYLDIFDEVEVGVRVQAIRGLPLFCKDTPDFISKIIDVLVQCLNTEEF
VERDAVHKALMSLFRQDTKASLTALFKHTEATLSTDEQIREKVLHFIRDKVFPLKGELLK
PQQEMERHITDLIKKSLGDVTGEEFNMFMDFLKSLSIFGGKAPQERMQELVEIIEGQADL
DSEFNVSDTDHIDRFISCLQTALPFFARGAPGSKFLNYLNKNIMPAFDQLPEERKLNLLR
ALAEMSPYTTAQVARQILPSIVQLLKKYMPARKTGEEMNFTYVECLLYVLHHLAHKAPNA
TNSLCGYKIVTGQPSDRLGEDFSEFNKEFTERLTSVEDLTKATMKKLTQGMSEHSKAMST
AKTDEEKSIVKTKKQSTTTGLRTCNNILAMTKGLHAKAPSFIGNTSVTLSWKEPTKVTKP
LASTTTGGKRPANGAGNNVGAKKARVQNQQQVVNKRSEGISHGGGRGSHRGRGRGQGQGR
HSGGGGGRGRGRRGFW

MSENQSEEVQQIEKLYEFSERLNASKDKSQNVEDYEGIIKMSKTSMKAKQLASQLIPRYF
KFFPSLSTEAFDAHMDCIDDGDLGVRVQAIRGLPLFCKDTPDILSKIVDVLVQLLNTEEP
VERDAVHKALMSLLRQDPKASSTALFTHAGVTPTTDDQIREKVLNFIRDKVIPLKGELLK
PQEEMERHITDLIKQSLEDVTGGEFKMFMDFLTSLSIFGGKAPPERMQELVEIIEGQADL
NAQFEFSDTDHIDRLISCLQLALPFFARGAPSSRFLIYLNKHIIPVFDKLPEERKLDLLK
ALADISPYTTAQEARQLLPSIVELLKIYMPARKTGEEMNFTYVECLLYAFHHLAHKVPNA
TNSLCGYKIVTGQPSDRLGEDFSELNKDFTERLTIVEDLTKATMKKLTQGMTEHNKAMSA
AKTDEEKASIKTKRQNTTTGLRTCNNILAMTKPLHAKVPPFIGDTNLNLSWKEATKPLAS
TTTTIGGKRPANSNNGSGNNVAAKKGRGSGTMQNQLVNKAFEGISSYGAGRGGNRGWGRR
GGGRGRGQGRGHW

Other information
Ka divergence:-0.232941KaKs divergence:0.0438005
GC content 1 (%):44GC content 2 (%):43GC content divergence:-0.011
Length 1 (bp):1671Length 2 (bp):1662Length divergence:-0.003
MFE 1 (kcal):-502.69MFE 2 (kcal):-514.57MFE divergence0.012