Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G29050-AT2G34070
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):TRICHOME BIREFRINGENCE-LIKE 38
Function (paralog2):TRICHOME BIREFRINGENCE-LIKE 37

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:0.27775061042757
Log2 mRNA fold difference:0.68526486071329
Log2 TE fold difference:-0.28035580808647
Sequences
Protein sequence

MGFKLISLLLLFLPLLTVTILSGVEQAFASDKALLVTGRNITADGGRSSLRGKKQRRASG
CNLFQGRWVFDASYPFYDSSKCPFIDGEFDCLKFGRPDKQFLKYSWQPESCTIPRFDGGA
FLRKYRGKRVMFVGDSLSLNMWESLACMIHASVPNAKTTFLKRTPLSTLTFQEYGVTLYL
YRTPYIVDISKERVGRVLNLGAIEGGADAWKNMDVLVFNSWHWWTHKGQSQGWDYIRDGS
SLVRDMNRLDAFYKGLSTWARWVDQNVDTAKTRVFFQGISPTHYEGREWNEPRKTCSGQM
QPLGGSSYPSGQPPSSGVVSKVLSSMKKPVTLLDITTLSQLRKDAHPSSYGGDGGTDCSH
WCLPGLPDTWNQLLYAALTM

MGFKLNSLFLLLSLLILTILSGADQALAYVKKPHVSQRNKTALAAVAGRGGGKEMLKGRK
QTSGCNLFQGRWVFDASYPFYDSSTCPFIDGEFDCLKFGRPDKQFLKYSWQPDSCTVPRF
DGEAFLKKWRGKRVMFVGDSLSLNMWESLACMIHSSVPNTKTTFLKRTPLSSLTFQEYDV
TLFLYRTPYLVDISKESVGRVLNLGAIEDGADAWKNMDLLVFNSWHWWTHTGVQSQGWDF
IRDGSSLMRDMDRLDAFNKGLTTWGQWVDQNVNVSQTRVFFQGISPTHYMGREWNEPRKT
CNGQMQPLTGSTYPGGSLPAASIVSRVLSTMRTPVYLLDITTLSQLRKDAHPSTYGGDGG
TDCSHWCLPGLPDTWNQLLYAALSM

Other information
Ka divergence:-0.0063974KaKs divergence:0.15702
GC content 1 (%):48GC content 2 (%):48GC content divergence:0
Length 1 (bp):1143Length 2 (bp):1158Length divergence:0.007
MFE 1 (kcal):-394.53MFE 2 (kcal):-379.61MFE divergence-0.019