Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G29160-AT2G34140
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Dof-type zinc finger DNA-binding family protein
Function (paralog2):Dof-type zinc finger DNA-binding family protein

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-0.63205555632299
Log2 mRNA fold difference:-1.1174806809844
Log2 TE fold difference:0.46051847533665
Sequences
Protein sequence

MATQDSQGIKLFGKTITFNANITQTIKKEEQQQQQQPELQATTAVRSPSSDLTAEKRPDK
IIPCPRCKSMETKFCYFNNYNVNQPRHFCKGCQRYWTAGGALRNVPVGAGRRKSKPPGRV
GGFAELLGAATGAVDQVELDALLVEEWRAATASHGGFRHDFPVKRLRCYTDGQSC

MATQDSQGIKLFGKTIAFNTRTIKNEEETHPPEQEATIAVRSSSSSDLTAEKRPDKIIAC
PRCKSMETKFCYFNNYNVNQPRHFCKGCHRYWTAGGALRNVPVGAGRRKSKPPGRVVVGM
LGDGNGVRQVELINGLLVEEWQHAAAAAHGSFRHDFPMKRLRCYSDGQSC

Other information
Ka divergence:-0.416409KaKs divergence:-0.121302
GC content 1 (%):50GC content 2 (%):50GC content divergence:0
Length 1 (bp):528Length 2 (bp):513Length divergence:-0.014
MFE 1 (kcal):-168.75MFE 2 (kcal):-170.78MFE divergence0.006