Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G29170-AT2G34150
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):SCAR family protein
Function (paralog2):SCAR family protein

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-0.91570461747764
Log2 mRNA fold difference:0.21907079534832
Log2 TE fold difference:-1.0540860985685
Sequences
Protein sequence

MPRNVYGMNQSEVYRNVDREDPKAILNGVAVTGLVGVLRQLGDLAEFAAEIFHGIQEEVM
ATASRSNQLKIRLQHIEATVPPLEKAMLAQTTHIHFAYTGGLEWHPRIPITQNHLIYDDL
PHIIMDPYEECRGPPRLHLLDKFDINGPGSCLKRYSDPTYFRRASSNLSQGNKKFQKDKK
HCKMKKKKTSSRSRDMSRLASLANQNARKTFASFSFSGQTSSTKTTSTSDMEKRYDFQDH
HSRSFESRSGSGYNECLSTATSSLKTGERPKGVFVSSSLTPGSCTIASVLSECETEDAHD
NFQFSPSQGQAARGSSCVSWDEKAEIVESLGLQTDEASEMVEANSVVDTLDEKPSYGEGI
GGVDFHSKDNENDKSESGLRKRAGIDEVREIKNGREIVGEPRDSEQETESEGECFVDALN
TIESESENNQGLQTSQVSSSCGVADERLEKSVCEQETEQNSYSVEDSCRSMDGLMANSFK
NEENASSENVSVEMHQQNLQAGSDINRLQKNDLCANKDMRNDSGGKDTITFTFVPGLENS
LVDSSNPLIHHGLQENQETEAESSGDLEAFKIWTNGGLLGLKPSKPPVLAMPSSLSPDCK
TEERTVGFAEAEKDKADDLVENASHRHVLNNSSLATPGTQNPGSSNGIVMGIVDQRESHE
TSSGVFGLSHKFLTSGFRRKDSFAHDRKTVPATIPENDEVTTERRRFCDQDINEKTFMDP
FRDEAPIDWITSSPPLQHMKISLNPADTLQASRLKLKFSDGDNTYNTFSSFQLLPETGTS
LPDSYSDDDTFCRSSPYMSDTDYLSDNHSLSNSEPWEESSDSHGRKEQELYDSFHESRHV
DNNAEASPLGIKSESSCVAVNLSYLQNPAEPLPPPFPPMQWMVSKTPSEKMEDKTQSLQL
QEALRFAFEKHISLPTAKNELPSMVTSAPKPEIKAHLKNNVREEKQSANAKETETGDFLQ
QIRTQQFNLRPVVMTTTSSATATTDPIINTKISAILEKANSIRQAVASKDGDESDTWSDT

MPLVRLQVRNVYGLGQKELHTKVDREDPKAILDDVAVSGLVGILRQLGDLTEFAAEIFHG
IQEEVMITASRSNKLKMRLKQIEAKVPTIQKTVLAQTNHIHFAYTGGLEWHPRIPNVQNH
FMYDELPPFIMTPYEDCREPPRLHLLDKFDINGPGSCLKRYSDPTHFKRASRASKPSEIK
KKKSIQRGRDISRLASVANQSDRKTCTSLSFSGRTSTSKTASTIEIESKSDLQEHRSFSF
DSRSGGEKPKRVSSSSRFTPGSRTIASVLSESESESDSPSQDLTARGSSSVSWHEKAEIV
ECNVLQCATDEAPEVMETNFVLDAEPVSRLKEHSAVEAVQDIKPKELEMDNEDETESEGD
DFVDALYTIDSESENDEAFQATKEVQKNLYNDITEQETEKISNNFSVDETKCAATSELHL
SSSPVYKSDELIHQDPWAASEISSGTHSYSNGFSNPLYDISGIQEHQESEEVESSCDTES
IKTWTNGNLLGLKPSKPKIIAETIPEIVEDIDSETFQEHLREDYKAPFDWFTSSPPLDHM
KISFKSSETLPSSELQLKLPDEYTFSSFQLVPETIATSLPDSDSDKDTFCRSSSYISDNS
DNDNRSVSMSEQQWEEESEGIRESKRQQELYDSFHRVNAEASSLPVPFPKIETTNGCLVE
NVSYLQNPAEPLPPPLPPLQWMVSKIPSAGFEDNNKQSLKDALTQAFEKNNNSLTAVKKK
EPHIVTVSDPKLVTKVHLKNNVRDYKQSHGNTNETEAGDFLHQIRTKQFNLRRVVRTKTS
SSETTMNTNISVILEKANSIRQAVASDDGEGESDTWSDSDT

Other information
Ka divergence:0.060963KaKs divergence:0.0616675
GC content 1 (%):42GC content 2 (%):40GC content divergence:-0.024
Length 1 (bp):3063Length 2 (bp):2466Length divergence:-0.108
MFE 1 (kcal):-888.01MFE 2 (kcal):-675.74MFE divergence-0.136